VYZKUMNY USTAV VETERINARNIHO LEKARSTVI, V. V. I. (Czech Republic)
Inventor
Nemec, Ivan
Starha, Pavel
Hosek, Jan
Pencikova, Katerina
Strakova, Nicol
Hezova, Renata
Simeckova, Pavlina
Abstract
The invention provides ionic half-sandwich coordination compounds of ruthenium and osmium in their oxidation state +II with ethane-1,2-diamine derivatives substituted by two polycyclic aromatic substituents. The compounds are useful for the treatment of cancers, in particular lung cancer. Furthermore, a method for preparation of the compounds is disclosed.
This invention concerns 1H-pyrrolo[3,2-c]quinoline compounds of formula (I) as inhibitors of tubuline polymerization. The invention also relates to the uses of such compounds and compositions, particularly their use in treating cancer. Formula (I)
A61K 31/4745 - QuinolinesIsoquinolines ortho- or peri-condensed with heterocyclic ring systems condensed with ring systems having nitrogen as a ring hetero atom, e.g. phenanthrolines
3.
POLYPEPTIDES MIMICKING MPER AND V3-LOOP HIV-1 ENV GLYCOPROTEIN EPITOPES
The present invention provides polypeptides having a length of up to 180 amino acids and containing a sequence selected from sequences identical or differing at most in 5 amino acids from the sequence: KSELAVEILEKGQVRFWMQAX21X22X23X24GNAKVNYIFNEKEIFEGPKYKMHIDXsoXsiXszGIIEM FMEKLQDEDEGTYTFQLQX76X77X78X79X80NHSTVVLVGDVFKKLQKEAEFQRQEWIRKQG (SEQ ID NO. 2), wherein X21X22X23X24 is selected from KAQQ (SEQ ID NO. 33), LSVF (SEQ ID NO. 34), ATPS (SEQ ID NO. 35), EIMW (SEQ ID NO. 36), DGSS (SEQ ID NO. 37), LLPL (SEQ ID NO. 38), WMWW (SEQ ID NO. 39), MNLY (SEQ ID NO. 40), MWRN (SEQ ID NO. 41), IMME (SEQ ID NO. 42), KHQL (SEQ ID NO. 43), HWQF (SEQ ID NO. 44), YAGN (SEQ ID NO. 45) and HGQW (SEQ ID NO. 46); X50X51X52 is selected from RNT, IMF, GHE, PSW, RAN, YFW, ITL, QAM, DMR, WLW, QGE, VQY and VSL; X76X77X78X79X80 is selected from SHHLG (SEQ ID NO. 47), FMLMM (SEQ ID NO. 48), VILIL (SEQ ID NO. 49), IVTPL (SEQ ID NO. 50), DFIIW (SEQ ID NO. 51), MWSE (deletion) (SEQ ID NO. 52), LYYAW (SEQ ID NO. 53), MMIEY (SEQ ID NO. 54), WMTQT (SEQ ID NO. 55), PQLWL (SEQ ID NO. 56), EPIFL (SEQ ID NO. 57) and QTATY (SEQ ID NO. 58); and optionally further having an affinity tag attached to the N-terminus or to the C-terminus of the sequence. These polypeptides mimic HIV-1 Env glycoprotein epitopes and are useful in preparation of antibodies and vaccines.
The invention relates to terpenoid derivatives, their use in the medicinal applications and compositions containing these derivatives. New generation of compounds possess selective antineurodegenerative properties on neuronal cells and tissues and can be particularly used in the treatment and prophylaxis of neurodegenerative disease, particularly in the treatment and prophylaxis of Parkinson's and Huntington's disease.
A61K 31/7056 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing five-membered rings with nitrogen as a ring hetero atom
A61K 31/4409 - Non-condensed pyridinesHydrogenated derivatives thereof only substituted in position 4, e.g. isoniazid, iproniazid
A61K 31/341 - Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide not condensed with another ring, e.g. ranitidine, furosemide, bufetolol, muscarine
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
6.
HETEROCYCLIC COMPOUNDS FOR THE PREVENTION AND THERAPY OF CIRCADIAN RHYTHM DISORDERS
FYZIOLOGICKY USTAV AV CR, V. V. I. (Czech Republic)
Inventor
Voller, Jiri
Mik, Vaclav
Dokonalova, Marketa
Sladek, Martin
Sumova, Alena
Hajduch, Marian
Strnad, Miroslav
Abstract
nn is 1 or 2 or 3; R1is H or C1-C4 alkyl; R2is selected from H, Cl, C1-C4 alkoxy and NR21R22, wherein R21and R22are independently selected from H, C3-C6 cycloalkyl and C1-C8 alkyl, wherein one carbon atom in the C1-C8 alkyl may optionally be replaced by one nitrogen or one oxygen atom; or wherein R21is H or C1-C4 alkyl and R22is selected from C6-C10 aryl-methyl, C6-10 aryl- ethyl, C3-C6 heteroaryl-methyl, C3-C6 heteroaryl-ethyl, wherein the heteroaryl group contains 1-2 heteroatoms selected from O, S, N; or wherein R21and R22 together with the nitrogen atom to which they are bound form a 3-to 8- membered ring optionally containing one further heteroatom selected from O, S, N; for use in the prevention and therapy of circadian rhythm diseases. These compounds are useful in the prevention and therapy of circadian rhythm diseases.
C07D 473/16 - Heterocyclic compounds containing purine ring systems with oxygen, sulfur, or nitrogen atoms directly attached in positions 2 and 6 two nitrogen atoms
C07D 473/34 - Nitrogen atom attached in position 6, e.g. adenine
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V.V.I. (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
Inventor
Cigler, Petr
Neburkova, Jitka
Schimer, Jiri
Guricova, Miroslava
Hajduch, Marian
Jaworek, Hana
Ondra, Martin
Kubickova, Agata
Abstract
Surface modified particles have a core, an inner shell and an outer shell. The core is formed of silica or is hollow, the inner shell is formed by a layer of metal, and the outer shell is formed by a biocompatible polymer brush. The particles allow for direct optical detection of biomolecules such as nucleic acids, proteins, polysaccharides and glycoproteins in biological samples.
The invention relates to brassinosteroid-derived cholestane derivatives, their use in the protection of cell damage, injury and cell death and compositions containing these derivatives. New generation of compounds possess also selective antineurodegenerative properties on neuronal cells and tissues and can be particularly used in the treatment and prophylaxis of neurodegenerative disease, particularly in the treatment and prophylaxis of Parkinson's disease.
C07J 9/00 - Normal steroids containing carbon, hydrogen, halogen, or oxygen, substituted in position 17 beta by a chain of more than two carbon atoms, e.g. cholane, cholestane, coprostane
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
A61K 47/08 - Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen
A61K 47/20 - Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing sulfur, e.g. dimethyl sulfoxide [DMSO], docusate, sodium lauryl sulfate or aminosulfonic acids
A61K 47/34 - Macromolecular compounds obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyesters, polyamino acids, polysiloxanes, polyphosphazines, copolymers of polyalkylene glycol or poloxamers
A61K 9/48 - Preparations in capsules, e.g. of gelatin, of chocolate
The present invention provides a method for preparation of sulfur functionalized graphene which contains the following steps: a) providing a dispersion of fluorinated graphite; b) subjecting the dispersion of fluorinated graphite to sonication and/or mechanical treatment and/or thermal treatment; c) preparing a metal polysulfide, starting from a metal sulfide and sulfur; d) contacting the product from step b) with the product of step c) at a temperature within the range of 10-110° C.; e) separating the solid product formed in step d) from the solution. Further provided are sulfur functionalized graphene with high sulfur loading obtained by this method, and its use in electrical cells.
: The present invention provides nitrogen doped graphene acid containing 3 to 10 at. % (preferably 4 to 6 at. %) of nitrogen and 25 to 45 at. % (preferably 30 to 38 at. %) of oxygen, relative to the total atoms present in the sample and determined by X-ray photoelectron spectroscopy (XPS) using an Al-Kα source. In some embodiments, the nitrogen doped graphene acid is in the form of dots. The nitrogen doped graphene acid is produced by a method which contains the following steps: - providing nitrogen doped graphene, - oxidizing the nitrogen doped graphene by reaction with an oxidizing inorganic acid, preferably with nitric acid, - washing the resulting mixture with water. The nitrogen doped graphene acid is particularly useful for sequestration of Pb2+and/or Cd2+from water or for detection of Pb2+and/or Cd2+.
The present invention provides nitrogen doped graphene acid containing 3 to 10 at. % (preferably 4 to 6 at. %) of nitrogen and 25 to 45 at. % (preferably 30 to 38 at. %) of oxygen, relative to the total atoms present in the sample and determined by X-ray photoelectron spectroscopy (XPS) using an Al-K source. In some embodiments, the nitrogen doped graphene acid is in the form of dots. The nitrogen doped graphene acid is produced by a method which contains the following steps: - providing nitrogen doped graphene, - oxidizing the nitrogen doped graphene by reaction with an oxidizing inorganic acid, preferably with nitric acid, - washing the resulting mixture with water. The nitrogen doped graphene acid is particularly useful for sequestration of Pb2+ and/or Cd2+ from water or for detection of Pb2+ and/or Cd2+.
The present invention provides a method of remediation of halogenated compound(s) from the aqueous environment, comprising a step of contacting the aqueous environment with particles containing or consisting of FexN, wherein x = 2-4.
B01J 20/02 - Solid sorbent compositions or filter aid compositionsSorbents for chromatographyProcesses for preparing, regenerating or reactivating thereof comprising inorganic material
C02F 1/28 - Treatment of water, waste water, or sewage by sorption
B01J 20/28 - Solid sorbent compositions or filter aid compositionsSorbents for chromatographyProcesses for preparing, regenerating or reactivating thereof characterised by their form or physical properties
13.
MESYLATE SALTS OF HETEROCYCLIC CYTOKININS, COMPOSITIONS CONTAINING THESE DERIVATIVES AND USE THEREOF
Object of the invention are mesylates of heterocyclic cytokinins of general formula I: (I) wherein R is selected from the group comprising C3-C15 cycloalkyl, furfuryl, allyl, 4-hydroxy-3-methylbut-2-en-1-yl, 3-methylbut-2-en-1-yl, 4-hydroxy-3-methylbutyl, 4-hydroxy-1,3-dimethylbut-2-en-1-yl, 4-hydroxy-1,3-dimethylbutyl, benzyl, wherein the cycloalkyl, allyl, benzyl and furfuryl may be unsubstituted or optionally substituted with 1 to 3 substituents selected from the group comprising hydroxy, halogen, methyl, hydroxymethyl and methoxy, and salts, solvates and addition salts therof. These compounds are particularly suitable for agricultural and biotechnological use, and their great advantage is increased water solubility as compared to the corresponding free bases of heterocyclic cytokinins
Object of the invention are mesylates of heterocyclic cytokinins of general formula I: (I) wherein R is selected from the group comprising C3-C15 cycloalkyl, furfuryl, allyl, 4-hydroxy-3-methylbut-2-en-1-yl, 3-methylbut-2-en-1-yl, 4-hydroxy-3-methylbutyl, 4-hydroxy-1,3-dimethylbut-2-en-1-yl, 4-hydroxy-1,3-dimethylbutyl, benzyl, wherein the cycloalkyl, allyl, benzyl and furfuryl may be unsubstituted or optionally substituted with 1 to 3 substituents selected from the group comprising hydroxy, halogen, methyl, hydroxymethyl and methoxy, and salts, solvates and addition salts therof. These compounds are particularly suitable for agricultural and biotechnological use, and their great advantage is increased water solubility as compared to the corresponding free bases of heterocyclic cytokinins
A01N 43/90 - Biocides, pest repellants or attractants, or plant growth regulators containing heterocyclic compounds having two or more relevant hetero rings, condensed among themselves or with a common carbocyclic ring system
14.
NITROGEN AND FLUORINE DOPED GRAPHENE AND USE THEREOF
A method is disclosed for preparation of nitrogen-doped graphene having these steps: a) providing a dispersion of fluorinated graphite; b) subjecting the dispersion of fluorinated graphite to sonication and/or mechanical treatment and/or thermal treatment; c) contacting the product from step b) with an azide reagent at a temperature within the range of 40 to 200° C.; d) separating the solid product formed in step c) from the mixture; e) dialyzing the product obtained in step d) against water. A nitrogen-doped graphene containing at least 8.9 at. % of nitrogen and up to 16.6 at. % of fluorine is yielded, wherein the at. % are relative to the total atoms present in the sample and determined by X-ray photoelectron spectroscopy (XPS) using an Al-Kα source; and having a density above 1.2 g/cm3 when pressed at 80 kN for 1 min. This nitrogen-doped graphene is particularly useful as a supercapacitor material.
The invention relates to heterocyclic purine cytokinin derivatives, their use in wound healing and pharmaceutical preparations containing these derivatives. These compounds stimulate endothelial cell division and migration, angiogenesis and vascularization and exhibit also anti-inflammatory properties.
A61K 31/7076 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid
A61P 17/02 - Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
The subject of the invention is a method of plasma diagnostics, in which an alternating voltage is applied to a reference electrode (6) with a measurable area AAP located in a plasma discharge chamber (1) and a first set of electric current and voltage waveforms is generated at the reference electrode (6). After the completion of the measurement, the differential conductivity of the space charge sheath around the surface of the reference electrode (6) and its capacity are calculated from the measured dependences. Subsequently, an alternating voltage of the same frequency is applied to the main electrode located in the plasma and covered with a thick dielectric, and a second set of electric current and voltage waveforms is generated on the main electrode (7). From the measured values, the complex impedance of the main electrode (7) is determined and then the area of the main electrode is calculated, from which it is possible to determine other parameters such as electron temperature, voltage of the wall sheath, ion concentration and ion flux and more.
cisHH-imidazole-derived ligands, a method of preparation thereof, and therapeutic use thereof, in particular for treating multiple myeloma. The complexes of the invention cause apoptotic cell death in multiple myeloma cells.
A profllometer with a swing arm (5) comprised of a base (1), on which a sample table (6) is mounted, where the arm (5) is mounted to swing horizontally on a supporting block (2) and one of its end sections overlaps the sample table (6), where at this end section of the arm (5), an object probe (61) is mounted sliding both along the longitudinal axis (Zl) of the arm (5) and also vertically, perpendicular to the longitudinal axis (Zl). Opposite the sample table (6) under the second end section of the arm (5) on the base (1) a standard table (7) is mounted and above it on the arm (5) a reference probe (71) is mounted sliding both along the longitudinal axis (Zl) of the arm (5) and also along the vertical axis (R2) perpendicular to the axis (Zl). The arm (5) is on the support block (2), mounted with its area positioned above the connecting line between the geometric centers of the sample table (6) and standard table (7), and the arm (5) is on the support block (2) mounted so as to swing vertically as well.
G01B 21/20 - Measuring arrangements or details thereof, where the measuring technique is not covered by the other groups of this subclass, unspecified or not relevant for measuring contours or curvatures, e.g. determining profile
G01B 21/04 - Measuring arrangements or details thereof, where the measuring technique is not covered by the other groups of this subclass, unspecified or not relevant for measuring length, width, or thickness by measuring coordinates of points
19.
System and method for adapting text-based data structures to text samples
Techniques for customizing multimedia content using data structures adapted to text samples. A method includes dividing a text sample into segments. Unique words are identified within the segments. For each unique word found in the segments, its neighboring words are identified. Based on sentiment values associated with those neighboring words, a sentiment of each unique is determined. Using the sentiments of the unique words, text skeletons are modified by inserting the unique words into corresponding locations within structured data of the text skeletons. The modified text skeletons may be inserted into multimedia content in order to customize that multimedia content to the text sample.
FYZIOLOGICKY USTAV AV CR, V. V. I. (Czech Republic)
Inventor
Voller, Jiri
Sladek, Martin
Hajduch, Marian
Sumova, Alena
Strnad, Miroslav
Abstract
N-(furan-2-ylmethyl)-7H-purin-6-amine, or a pharmaceutically acceptable salt or solvate thereof, for prevention and/or treatment of circadian rhythm disorders, circadian rhythm diseases and/or circadian rhythm dysfunctions is disclosed. The disorders, diseases and dysfunctions include, inter alia, jet-lag, social jet-lag, shift-work disorder, and circadian rhythm disturbance induced by neurodegeneration is also disclosed.
A61K 31/4045 - Indole-alkylaminesAmides thereof, e.g. serotonin, melatonin
A61K 31/343 - Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide condensed with a carbocyclic ring, e.g. coumaran, bufuralol, befunolol, clobenfurol, amiodarone
A61K 31/165 - Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide
A61K 31/198 - Alpha-amino acids, e.g. alanine or edetic acid [EDTA]
A61K 31/136 - Amines, e.g. amantadine having aromatic rings, e.g. methadone having the amino group directly attached to the aromatic ring, e.g. benzeneamine
A61K 31/675 - Phosphorus compounds having nitrogen as a ring hetero atom, e.g. pyridoxal phosphate
A61K 31/175 - Amides, e.g. hydroxamic acids having the group N—C(O)—N or N—C(S)—N, e.g. urea, thiourea, carmustine having the group , N—C(O)—N=N— or , e.g. carbonohydrazides, carbazones, semicarbazides, semicarbazonesThioanalogues thereof
A61K 31/4184 - 1,3-Diazoles condensed with carbocyclic rings, e.g. benzimidazoles
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V. V. I. (Czech Republic)
MIKROBIOLOGICKY USTAV AV CR, V. V. I. (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
Inventor
Rejman, Dominik
Pohl, Radek
Mojr, Viktor
Do Pham, Duy Dinh
Kolar, Milan
Krasny, Libor
Abstract
Lipophosphonoxins of general formula I, diastereomers and mixtures of diastereomers of compounds of general formula I and their pharmaceutically acceptable salts and hydrates as antibacterial agents, forming an active ingredient in pharmaceutical compositions for the treatment of resistant bacterial infections, disinfectants and/or selective culture media is disclosed.
A device for the measurement of the spectral reflectance, in particular concave spherical mirror surfaces, using a light source and a reference measurement, measurement, the essence of which consists of an interchangeable illumination block (2) and a detection block (3), which are installed near the centre (11) of curvature of the measured mirror surface (1), wherein both the illumination block (2) comprises a light source (21) and a beam reducer (22) provided with a aperture (221) and the detection block (3) comprises a hollow integrating sphere (31), to which a photodetector (33) connected to a control and evaluation computer (4) is connected, and secondly, the integrating sphere (31) is provided with an input port (311) on part of its surface, against which, on an opposite part of the inner surface of the integrating sphere (31), an affected area (312) is defined for measuring the radiation characteristics of a light beam (211) initiated in the light source (21) and passing through the aperture (221) of the beam reducer (22) and the input port (311) of the integrating sphere (31).
A polypeptide mimicking epitope of glycoprotein gp120 of HIV-1 virus that is recognized by a paratope of broadly neutralizing antibody VRC01 and has the length up to 100 amino acid residues and contains an amino acid sequence:
A polypeptide mimicking epitope of glycoprotein gp120 of HIV-1 virus that is recognized by a paratope of broadly neutralizing antibody VRC01 and has the length up to 100 amino acid residues and contains an amino acid sequence:
(SEQ ID NO. 1):
X1YKNX2INX3AX4X5VX6X7VKRX8IDX9ILAX10LP
X1 is selected from amino acids A, N, R;
X2 is selected from amino acids A, R, D;
X3 is selected from amino acids R, V, P;
X4 is selected from amino acids V, L, S;
X5 is selected from amino acids T, G, R;
X6 is selected from amino acids G, T;
X7 is selected from amino acids L, A;
X8 is selected from amino acids V, I;
X9 is selected from amino acids G, A, R;
X10 is selected from amino acids R, A, G;
with a directly attached alpha-helical structure at the N-terminus or C-terminus is disclosed.
The invention relates to stabilized zerovalent iron nanoparticles having a zerovalent iron core and further having a polymer shell; the nanoparticles being free of any stabilizing inorganic oxide, hydroxide or carbon layer on the surface of the nanoparticle core. Furthermore, the invention relates to a method of preparation of stabilized zerovalent iron nanoparticles, comprising the steps of providing a solution of a polymer in a non-aqueous solvent, and contacting the said solution with zerovalent iron nanoparticles.
22 nanocrystals; - preparing an S2- ligand exchange solution by dissolving a sulfide in a mixture of water and a polar solvent; - contacting the product from step a) with the product of step c) under continuous stirring; - separating the solid product formed in step d) from the solution. The sulfide coated copper iron sulfide nanocrystals are useful as photocatalysts for catalytic reduction of nitroaromatic compounds.
C07C 209/32 - Preparation of compounds containing amino groups bound to a carbon skeleton by reduction of nitrogen-to-oxygen or nitrogen-to-nitrogen bonds by reduction of nitro groups
26.
TEST STRIP FOR SURFACE-ENHANCED RAMAN SPECTROSCOPY, METHOD FOR ITS PREPARATION AND USE THEREOF
The present invention relates to a test strip for surface-enhanced Raman spectroscopy, which comprises a plastic substrate (B), to which a nitrocellulose membrane (C) is attached, the nitrocellulose membrane (C) comprising covalently anchored silver and/or gold nanoparticles (D), wherein the test strip further contains a sample part (A) with modified adhesion for an easy application of the sample and an absorption part (F) for absorbing the sample passed through the test strip, wherein the sample part (A), and the absorption part (E) are located at opposite ends of the test strip, and are adapted to freely transfer liquid (sample) from its application onto the sample part (A) until its absorption in the absorption part (E). The present invention further relates to a method for preparing the test strip and to the use thereof.
G01N 21/77 - Systems in which material is subjected to a chemical reaction, the progress or the result of the reaction being investigated by observing the effect on a chemical indicator
G01N 21/84 - Systems specially adapted for particular applications
B82Y 30/00 - Nanotechnology for materials or surface science, e.g. nanocomposites
27.
POLYPEPTIDES MIMICKING MPER AND V3-LOOP HIV-1 ENV GLYCOPROTEIN EPITOPES
21222324767778798080NHSTVVLVGDVFKKLQKEAEFQRQEWIRKQG (SEQ ID NO. 2), wherein X21X22X23X24 is selected from KAQQ (SEQ ID NO. 33), LSVF (SEQ ID NO. 34), ATPS (SEQ ID NO. 35), EIMW (SEQ ID NO. 36), DGSS (SEQ ID NO. 37), LLPL (SEQ ID NO. 38), WMWW (SEQ ID NO. 39), MNLY (SEQ ID NO. 40), MWRN (SEQ ID NO. 41), IMME (SEQ ID NO. 42), KHQL (SEQ ID NO. 43), HWQF (SEQ ID NO. 44), YAGN (SEQ ID NO. 45) and HGQW (SEQ ID NO. 46); X50X51X52 is selected from RNT, IMF, GHE, PSW, RAN, YFW, ITL, QAM, DMR, WLW, QGE, VQY and VSL; X76X77X78X79X8O is selected from SHHLG (SEQ ID NO. 47), FMLMM (SEQ ID NO. 48), VILIL (SEQ ID NO. 49), IVTPL (SEQ ID NO. 50), DFIIW (SEQ ID NO. 51), MWSE(deletion) (SEQ ID NO. 52), LYYAW (SEQ ID NO. 53), MMIEY (SEQ ID NO. 54), WMTQT (SEQ ID NO. 55), PQLWL (SEQ ID NO. 56), EPIFL (SEQ ID NO. 57) and QTATY (SEQ ID NO. 58); and optionally further having an affinity tag attached to the N -terminus or to the C -terminus of the sequence. These polypeptides mimic HIV-1 Env glycoprotein epitopes and are useful in preparation of antibodies and vaccines.
C07K 14/47 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans from vertebrates from mammals
C07K 16/10 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
28.
BIOCHAR-BASED COMPOSITES FOR DECONTAMINATION OF CHEMICAL WARFARE AGENTS
The present invention relates to a composite material containing biochar support and alkaline earth metal oxide nanoparticles, wherein the alkaline earth metal oxide nanoparticles are embedded in the biochar support or adsorbed on the biochar support. The composite material is used in a method of decontamination of chemical warfare agents, which comprises the step of contacting a chemical warfare agent to be decontaminated with the composite material comprising biochar and alkaline earth metal oxide nanoparticles.
B01J 20/04 - Solid sorbent compositions or filter aid compositionsSorbents for chromatographyProcesses for preparing, regenerating or reactivating thereof comprising inorganic material comprising compounds of alkali metals, alkaline earth metals or magnesium
B01J 20/20 - Solid sorbent compositions or filter aid compositionsSorbents for chromatographyProcesses for preparing, regenerating or reactivating thereof comprising inorganic material comprising free carbonSolid sorbent compositions or filter aid compositionsSorbents for chromatographyProcesses for preparing, regenerating or reactivating thereof comprising inorganic material comprising carbon obtained by carbonising processes
B01J 20/28 - Solid sorbent compositions or filter aid compositionsSorbents for chromatographyProcesses for preparing, regenerating or reactivating thereof characterised by their form or physical properties
B01J 20/30 - Processes for preparing, regenerating or reactivating
B01D 53/02 - Separation of gases or vapoursRecovering vapours of volatile solvents from gasesChemical or biological purification of waste gases, e.g. engine exhaust gases, smoke, fumes, flue gases or aerosols by adsorption, e.g. preparative gas chromatography
C02F 1/28 - Treatment of water, waste water, or sewage by sorption
A62D 3/33 - Processes for making harmful chemical substances harmless, or less harmful, by effecting a chemical change in the substances by reacting with chemical agents by chemically fixing the harmful substance, e.g. by chelation or complexation
A62D 3/36 - Detoxification by using acid or alkaline reagents
29.
DEVICE FOR DEPOSITION OF DIELECTRIC OPTICAL THIN FILMS BY THE HELP OF SPUTTERING PLASMA SOURCES AND SOURCES OF ENERGY IONS
Device for deposition of dielectric optical thin films by the help of sputtering plasma sources and sources of energy ions which is formed with a vacuum chamber (1) whose inner volume (101) is through a regulation valve (2) connected with a vacuum pump (3), where the vacuum chamber (1) is in its upper part equipped with an entrance flange (102) for possibility of supply of working gas which is Into the inner volume (101) blown through a mas flowmeter (4) whereas in the Inner volume (101) are opposed a controlled ion source (5) and a pivoted and heated substrate holder (6) and between them are placed a system of sputtering plasma sources (?) which together with the ion source (S) generate flow of neutral and ionized particles. The essence of the invention is that above the pivoted substrate holder (8) is placed a system of at least two stationary high frequency probes (8) for possibility of measurement in real time ion flow and ion energy distribution function of landing ions at given place of placement of the samples of the substrate (9) on the substrate holder (8) whereas not only the ion source (5) is connected with the first power supply unit (10) and the sputtering plasma sources (?) with the second power supply unit (11) when both power supply units (10) and (11) are placed outside of the vacuum chamber (1) but also the substrate holder (6) is connected with a control unit (12) which is also placed outside of the vacuum chamber (1) and also there is, as an integrated part of the device, a processing and control unit (13) which is also placed outside of the vacuum chamber (1) and which is in parallel connected with the first power supply unit (10), the second power supply unit (11) and Individually with each stationary high frequency probe (8) when the connection with particular stationary high frequency probes (8) is realized through digitizers (14) which are placed outside of the vacuum chamber (1).
The invention relates to terpenoid derivatives, their use in the medicinal applications and compositions containing these derivatives. New generation of compounds possess selective antineurodegenerative properties on neuronal cells and tissues and can be particularly used in the treatment and prophylaxis of neurodegenerative disease, particularly in the treatment and prophylaxis of Parkinson's and Huntington's disease.
C07J 41/00 - Normal steroids containing one or more nitrogen atoms not belonging to a hetero ring
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
A61K 31/56 - Compounds containing cyclopenta[a]hydrophenanthrene ring systemsDerivatives thereof, e.g. steroids
09 - Scientific and electric apparatus and instruments
10 - Medical apparatus and instruments
42 - Scientific, technological and industrial services, research and design
44 - Medical, veterinary, hygienic and cosmetic services; agriculture, horticulture and forestry services
Goods & Services
Scientific apparatus and instruments; Meter testing apparatus; Diagnostic apparatus, not for medical purposes; Scientific specimens for laboratory use; Cell culture apparatus for laboratory use; Laboratory instrument for the detection of pathogens and toxins in a biological sample for research use. Medical apparatus and instruments; Veterinary apparatus and instruments; Diagnostic apparatus for medical purposes; Tools for veterinary diagnostics; Testing apparatus for medical purposes; Detecting instruments for veterinary use; Apparatus, for use in the following fields: Animal tissue sampling; Testing instruments for medical diagnostic purposes; Testing instruments for medical diagnostic purposes. Chemical analysis; Scientific research for medical purposes; Scientific research for veterinary purposes; Analytical laboratory services; Analysis in the field of molecular biology; Biochemistry research services; Biological research; Biochemical research and analysis; Biological laboratory services; Design and development of medical diagnostic apparatus; Consultancy in the fields of measuring, testing and analysis; Providing information on the subject of scientific research in the field of biochemistry and biotechnology; Science and technology services; Technological consultancy; Computer aided diagnostic testing services; Laboratory services; Veterinary laboratory services; Provision of information and data relating to medical and veterinary research and development; Performing of tissue sampling services. Medical and healthcare services; Medical diagnostic services; Medical laboratory services for the analysis of samples taken from patients; Medical analysis services for diagnostic and treatment purposes provided by medical laboratories; Animal healthcare services; Animal healthcare services; Taking of tissue samples from animals; Medical services relating to the removal, treatment and processing of human cells; Animal healthcare services, in relation to the following fields: Collection, modification and processing of animal cells.
32.
Heterocyclic nitrogen-containing purine derivatives, pharmaceutical preparations containing these derivatives and their use in neuroprotection
Heterocyclic nitrogen-containing purine derivatives and their use in the medicinal applications and compositions containing these derivatives is disclosed. A new generation of compounds possessing selective antineurodegenerative properties on neuronal cells and tissues and that can be particularly used in the treatment and prophylaxis of neurodegenerative disease, particularly in the treatment and prophylaxis of Parkinson's disease is also disclosed.
C07D 473/16 - Heterocyclic compounds containing purine ring systems with oxygen, sulfur, or nitrogen atoms directly attached in positions 2 and 6 two nitrogen atoms
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
33.
CHOLESTANE DERIVATIVES, PREPARATIONS CONTAINING THESE DERIVATIVES AND USE THEREOF
The invention relates to brassinosteroid-derived cholestane derivatives, their use in the protection of cell damage, injury and cell death and compositions containing these derivatives. New generation of compounds possess also selective antineurodegenerative properties on neuronal cells and tissues and can be particularly used in the treatment and prophylaxis of neurodegenerative disease, particularly in the treatment and prophylaxis of Parkinson's disease.
C07J 9/00 - Normal steroids containing carbon, hydrogen, halogen, or oxygen, substituted in position 17 beta by a chain of more than two carbon atoms, e.g. cholane, cholestane, coprostane
C07J 11/00 - Normal steroids containing carbon, hydrogen, halogen, or oxygen, not substituted in position 3
A61K 31/575 - Compounds containing cyclopenta[a]hydrophenanthrene ring systemsDerivatives thereof, e.g. steroids substituted in position 17 beta by a chain of three or more carbon atoms, e.g. cholane, cholestane, ergosterol, sitosterol
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V.V.I. (Czech Republic)
Inventor
Cigler, Petr
Neburkova, Jitka
Schimer, Jiri
Guricova, Miroslava
Hajduch, Marian
Jaworek, Hana
Ondra, Martin
Kubickova, Agata
Abstract
The invention provides surface-modified particles comprising a core, an inner shell and an outer shell, wherein the core is formed of silica or is hollow, the inner shell is formed by a layer of metal and the outer shell is formed by a biocompatible polymer brush. The particles allow for direct optical detection of biomolecules such as nucleic acids, proteins, polysaccharides and glycoproteins in biological samples.
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V. V. I. (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
Inventor
Cigler, Petr
Neburkova, Jitka
Schimer, Jiri
Guricova, Miroslava
Hajduch, Marian
Jaworek, Hana
Ondra, Martin
Kubickova, Agata
Abstract
The invention provides surface-modified particles comprising a core, an inner shell and an outer shell, wherein the core is formed of silica or is hollow, the inner shell is formed by a layer of metal and the outer shell is formed by a biocompatible polymer brush. The particles allow for direct optical detection of biomolecules such as nucleic acids, proteins, polysaccharides and glycoproteins in biological samples.
The present invention provides a method for preparation of sulfur functionalized graphene which contains the following steps: a) providing a dispersion of fluorinated graphite; b) subjecting the dispersion of fluorinated graphite to sonication and/or mechanical treatment and/or thermal treatment; c) preparing a metal polysulfide, starting from a metal sulfide and sulfur; d) contacting the product from step b) with the product of step c) at a temperature within the range of 10-110°C; e) separating the solid product formed in step d) from the solution. Further provided are sulfur functionalized graphene with high sulfur loading obtained by this method, and its use in electrical cells.
: The present invention provides a cell culture device containing a substantially planar support, which further contains a polymeric film containing one or more polyelectrolytes provided on at least one surface of the support, and a plurality of plasmonic nanoparticles electrostatically bonded to the surface of the polymeric film. Such device is useful for methods of thermal micro-irradiation of cells.
The invention relates to N2,N6-disubstituted-9-(2-oxacycloalkyl)-9H-purine-2,6-diamine derivatives and their use as prodrugs and in agriculture and biotechnology. The compounds of the present invention exhibit a number of biological activities associated with stress inhibition, especially senescence, growth regulation and yiled formation biological activities. The invention also relates to agricultural and biotechnological compositions containing such derivatives as active agents.
ADAPTER OF SAMPLE HOLDER FOR EVALUATION OF MECHANICAL DURABILITY OF THIN FILMS AND METHOD FOR EVALUATION OF QUALITY OF MECHANICAL DURABILITY OF THIN FILMS VIA THIS ADAPTER
The invention is an adapter of sample holder for pursuance of method for evaluation of quality of mechanical durability of thin films which is formed by a hollow body (1), whose shell (101) is from below closed with a lid (8) which allows fixation of the adapter to a console of the holder of testing device and from above with a contact front face (2), on which is not only from the top fixed a tested sample (3) consisting of a substrate (31) and on it deposited thin film (32) but also there is from the bottom fixed a piezoelectric sensor (4) of acoustic emission which is equipped with a mechanical damper (5) and a preamplifier (6) of an electric signal which is through a connector (41) taken out from the body (1), where the essence of the invention is that the shell (101) and the contact front face (2) are designed as an assembly of two individual structural parts with different material composition, whereas the contact front face (2) is made of a transparent material which has mechanical stiffness and stability with the value of Young's modulus of elasticity higher than 40 GPa and at the place of its fixation there is an inner peripheral recess (103) in the shell (101), in which is placed LED illumination (7) which is connected through a coupler (71) with a source of electric energy which is placed outside of the body (1). Likewise, is the invention the method of evaluation of quality of mechanical durability of thin films deposited on transparent substrate with use of continuous monitoring and record of acoustic emission during low cycle repetitive scratch test with subcritical force by the help of the adapter.
G01N 3/56 - Investigating resistance to wear or abrasion
G01N 3/46 - Investigating hardness or rebound hardness by performing impressions under a steady load by indentors, e.g. sphere, pyramid the indentors performing a scratching movement
G01N 29/14 - Investigating or analysing materials by the use of ultrasonic, sonic or infrasonic wavesVisualisation of the interior of objects by transmitting ultrasonic or sonic waves through the object using acoustic emission techniques
G01N 21/88 - Investigating the presence of flaws, defects or contamination
G01N 19/06 - Investigating by removing material, e.g. spark-testing
40.
MESYLATE SALTS OF HETEROCYCLIC CYTOKININS, COMPOSITIONS CONTAINING THESE DERIVATIVES AND USE THEREOF
Object of the invention are mesylates of heterocyclic cytokinins of general formula I: (I) wherein R is selected from the group comprising C3-C15 cycloalkyl, furfuryl, allyl, 4-hydroxy-3-methylbut-2-en-1-yl, 3-methylbut-2-en-1-yl, 4-hydroxy-3-methylbutyl, 4-hydroxy-1,3-dimethylbut-2-en-1-yl, 4-hydroxy-1,3-dimethylbutyl, benzyl, wherein the cycloalkyl, allyl, benzyl and furfuryl may be unsubstituted or optionally substituted with 1 to 3 substituents selected from the group comprising hydroxy, halogen, methyl, hydroxymethyl and methoxy, and salts, solvates and addition salts therof. These compounds are particularly suitable for agricultural and biotechnological use, and their great advantage is increased water solubility as compared to the corresponding free bases of heterocyclic cytokinins.
C07D 473/34 - Nitrogen atom attached in position 6, e.g. adenine
A01N 3/00 - Preservation of plants or parts thereof, e.g. inhibiting evaporation, improvement of the appearance of leavesGrafting wax
A01N 43/34 - Biocides, pest repellants or attractants, or plant growth regulators containing heterocyclic compounds having rings with one nitrogen atom as the only ring hetero atom
A polarizing optical separator for stellar intensity interferometry, particularly for use in atmospheric Cherenkov detector, where the separator consists of a fixed optical setup (2) and a rotaiy optical setup (3), where the fixed optical setup (2) is formed by a beam splitter (21) to which a primary mirror prism (22) is attached in the direction of an incidental input beam (Sin) and a deflecting mirror prism (23) is attached in the direction perpendicular to the input beam (Sin), where the primary mirror prism (22) is followed by a secondary mirror prism (24) fitted with the first polarizer (25) on the output surface, and where the rotatable optical setup (3) is formed by a transitive prism (31) provided with the other polarizer (32) on an output surface and is rotatably attached to the deflecting mirror prism (23). The fixed optical setup (2) and the rotatable optical setup (3) are provided with detectors (4) and moreover they are selected so that the optical paths of the split output beams (Sd1) and (Sd2) in both separator arms are essentially identical.
The present invention provides a method for preparation of nitrogen-doped graphene which contains the following steps: a) providing a dispersion of fluorinated graphite; b) subjecting the dispersion of fluorinated graphite to sonication and/or mechanical treatment and/or thermal treatment; c) contacting the product from step b) with an azide reagent at a temperature within the range of 40 to 200 °C; d) separating the solid product formed in step c) from the mixture; e) dialyzing the product obtained in step d) against water. The method yields a nitrogen-doped graphene containing at least 8.9 at. % of nitrogen and up to 16.6 at. % of fluorine, wherein the at. % are relative to the total atoms present in the sample and determined by X-ray photoelectron spectroscopy (XPS) using an Al-Κα source; and having a density above 1.2 g/cm3 when pressed at 80 kN for 1 min. The thus obtained nitrogen-doped graphene is particularly useful as a supercapacitor material.
The present invention provides a method for preparation of nitrogen-doped graphene which contains the following steps: a) providing a dispersion of fluorinated graphite; b) subjecting the dispersion of fluorinated graphite to sonication and/or mechanical treatment and/or thermal treatment; c) contacting the product from step b) with an azide reagent at a temperature within the range of 40 to 200 °C; d) separating the solid product formed in step c) from the mixture; e) dialyzing the product obtained in step d) against water. The method yields a nitrogen-doped graphene containing at least 8.9 at. % of nitrogen and up to 16.6 at. % of fluorine, wherein the at. % are relative to the total atoms present in the sample and determined by X-ray photoelectron spectroscopy (XPS) using an Al-?? source; and having a density above 1.2 g/cm3 when pressed at 80 kN for 1 min. The thus obtained nitrogen-doped graphene is particularly useful as a supercapacitor material.
The present invention provides a device for automated preparation of seed samples, in particular samples for plant phenotyping, said device comprising a movable robotic arm (120) with a vacuum gripper (121) equipped with a hollow needle (122) configured to grip a seed by means of vacuum suction, a holder (111) for at least one plant cultivation vessel, a holder for at least one seed container, and a system for detecting the gripping of a seed.
The present invention relates to substituted 2-(3-phenylureido)benzamide derivatives of the general formula (I), wherein R1 is hydrogen, amino group, (C1 to C5)alkyl, (C2 to C5)alkenyl or (C2 to C5)alkynyl, optionally substituted with hydroxy or amino group, R2 is hydrogen, halogen, methoxy group or halogenated methoxy group and R3 and R4 are selected from the group consisting of hydrogen, halogen, methoxy group or trifluoromethoxy group. The compounds of general formula (I) inhibit one of the key plant enzymes cytokinin oxidase/dehydrogenase (CKX). The invention further relates to the use of these compounds in agriculture as biostimulators of plant growth, development and yield, and to increase their resistance to stress and to delay the senescence of plants. The present invention further relates to preparations for the treatment of plants containing these derivatives.
A01N 47/30 - Derivatives containing the group N—CO—N—aryl or N—CS—N—aryl
C07C 275/42 - Derivatives of urea, i.e. compounds containing any of the groups the nitrogen atoms not being part of nitro or nitroso groups having nitrogen atoms of urea groups bound to carbon atoms of six-membered aromatic rings of a carbon skeleton being further substituted by carboxyl groups
1525251515252555) alkylamino group is optionally substituted with hydroxy and/or amino group; and R3 and R4 are independently hydrogen or halogen, and wherein when X is nitrogen, then R2 is hydrogen or halogen. The invention further relates to the use of these substances in agriculture as stimulators of plant growth and development and as anti-stress factors and to the preparations containing these derivatives.
A01N 47/30 - Derivatives containing the group N—CO—N—aryl or N—CS—N—aryl
A01N 47/36 - Ureas or thioureas containing the groups N—CO—N or N—CS—N containing the group N—CO—N directly attached to at least one heterocyclic ringThio-analogues thereof
C07C 275/32 - Derivatives of urea, i.e. compounds containing any of the groups the nitrogen atoms not being part of nitro or nitroso groups having nitrogen atoms of urea groups bound to carbon atoms of six-membered aromatic rings of a carbon skeleton being further substituted by singly-bound oxygen atoms
C07C 275/34 - Derivatives of urea, i.e. compounds containing any of the groups the nitrogen atoms not being part of nitro or nitroso groups having nitrogen atoms of urea groups bound to carbon atoms of six-membered aromatic rings of a carbon skeleton being further substituted by singly-bound oxygen atoms having nitrogen atoms of urea groups and singly-bound oxygen atoms bound to carbon atoms of the same non-condensed six-membered aromatic ring
The present invention relates to new pyrazole-indole derivatives conjugated by ethene, buta-1,3-diene or ethyne linkers and containing substituents at R1, R2and R3positions of the general formula I which can be used in photodynamic therapy of cancer or bacterial infections. The invention further includes pharmaceutical compositions containing the conjugated pyrazole-indoline derivatives. (I)
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V.V.I. (Czech Republic)
MIKROBIOLOGICKY USTAV AV CR, V.V.I. (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
Inventor
Rejman, Dominik
Pohl, Radek
Mojr, Viktor
Do Pham, Duy Dinh
Kolar, Milan
Krasny, Libor
Abstract
Described herein are lipophosphonoxins of general formula I, diastereomers and mixtures of diastereomers of compounds of general formula I and their pharmaceutically acceptable salts and hydrates as antibacterial agents, forming an active ingredient in pharmaceutical compositions for the treatment of resistant bacterial infections, disinfectants and/or selective culture media.
A61K 31/683 - Diesters of a phosphorus acid with two hydroxy compounds, e.g. phosphatidylinositols
A61K 31/685 - Diesters of a phosphorus acid with two hydroxy compounds, e.g. phosphatidylinositols one of the hydroxy compounds having nitrogen atoms, e.g. phosphatidylserine, lecithin
FYZIOLOGICKY USTAV AV CR, V. V. I. (Czech Republic)
Inventor
Voller, Jiri
Sladek, Martin
Hajduch, Marian
Sumova, Alena
Strnad, Miroslav
Abstract
The present invention relates to N-(furan-2-ylmethyl)-7H-purin-6-amine, or a pharmaceutically acceptable salt or solvate thereof, for use in prevention and/or treatment of circadian rhythm disorders, circadian rhythm diseases and/or circadian rhythm dysfunctions. The disorders, diseases and dysfunctions include, inter alia, jet-lag, social jet-lag, shift-work disorder, and circadian rhythm disturbance induced by neurodegeneration.
A61K 31/506 - PyrimidinesHydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
A61K 31/4045 - Indole-alkylaminesAmides thereof, e.g. serotonin, melatonin
A61K 31/403 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
A61K 31/4439 - Non-condensed pyridinesHydrogenated derivatives thereof containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. omeprazole
A61K 31/437 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a five-membered ring having nitrogen as a ring hetero atom, e.g. indolizine, beta-carboline
A61K 31/337 - Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having four-membered rings, e.g. taxol
A61K 31/4745 - QuinolinesIsoquinolines ortho- or peri-condensed with heterocyclic ring systems condensed with ring systems having nitrogen as a ring hetero atom, e.g. phenanthrolines
A61K 31/475 - QuinolinesIsoquinolines having an indole ring, e.g. yohimbine, reserpine, strychnine, vinblastine
A61K 31/4025 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil not condensed and containing further heterocyclic rings, e.g. cromakalim
A61K 45/06 - Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V. V. I. (Czech Republic)
MIKROBIOLOGICKY USTAV AV CR, V. V. I. (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
Inventor
Rejman, Dominik
Pohl, Radek
Mojr, Viktor
Do Pham, Duy Dinh
Kolar, Milan
Krasny, Libor
Abstract
Described herein are lipophosphonoxins of general formula I, diastereomers and mixtures of diastereomers of compounds of general formula I and their pharmaceutically acceptable salts and hydrates as antibacterial agents, forming an active ingredient in pharmaceutical compositions for the treatment of resistant bacterial infections, disinfectants and/or selective culture media.
The invention relates to novel dihydrobenzofurane derivatives and their use as cosmetics and medicaments. These compounds possess antibacterial, anti-inflammatory and antioxidative properties. The invention relates also to compositions, preferably antibacterial toothpaste and mouthwash formulations which contain these derivatives as active compounds.
C07D 307/82 - Benzo [b] furansHydrogenated benzo [b] furans with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to carbon atoms of the hetero ring
A61K 31/343 - Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide condensed with a carbocyclic ring, e.g. coumaran, bufuralol, befunolol, clobenfurol, amiodarone
52.
POLYPEPTIDES MIMICKING EPITOPE OF BROADLY NEUTRALIZING ANTIBODY VRC01 AS ANTIGENS FOR A VACCINE PREVENTING HIV-1 INFECTION
BIOTECHNOLOGICKY USTAV AVCR, V. V. I. (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
Inventor
Maly, Petr
Raska, Milan
Kuchar, Milan
Kosztyu, Petr
Turanek, Jaroslav
Petrokova, Hana
Abstract
The present invention provides a polypeptide mimicking epitope of glycoprotein gp120 of HIV-1 virus, which is recognized by a paratope of broadly neutralizing antibody VRC01, has the length up to 100 amino acid residues and contains an amino acid sequence: X1YKNX2INX3AX4X5VX6X7VKRX8IDX9ILAX10LP (SEQ ID NO. 1),, in which: X1is selected from amino acids A, N, R; X2is selected from amino acids A, R, D; X3is selected from amino acids R, V, P; X4is selected from amino acids V, L, S; X5is selected from amino acids T, G, R; X6is selected from amino acids G, T; X7is selected from amino acids L, A; X8is selected from amino acids V, I; X9is selected from amino acids G, A, R; X10 is selected from amino acids R, A, G; with a directly attached alpha-helical structure at the N-terminus or C-terminus.
bb'NN-donor ligand derived from 1,10-phenanthroline of the general formula (III) or 2,2'-bipyridine of the general formula (IV), and X represents a monoanion of acid selected from the group of: Cl-33 -44 -44 -44 -, HCOO-33COO-cisplatincisplatin and/or human breast adenocarcinoma, human prostate carcinoma and/or human colorectal adenocarcinoma and/or human osteosarcoma and/or human lung adenocarcinoma.
The present disclosure refers to a method of measuring resistance of the resistive sensor (5), where the value of resistance of the resistive sensor (5) is determined from its series connection with actively controlled resistor network (3) with selectable value of resistance and with a periodic waveform voltage source (7), and further a device for measuring resistance of the resistive sensor (5) including a periodic waveform voltage source (7), actively controlled resistor network (3), and a resistive sensor (5), wherein the terminals of the periodic waveform voltage source (7) are connected to the first node (2) and the third node (6), terminals of actively controlled resistor network (3) are connected to the first node (2) and the second node (4), and terminals of the resistive sensor are connected to the second node (4) and the third node (6), thus forming a connection in a resistive voltage divider with an automatic selection of one resistor of the divider, and usage of this method for measuring time-varying resistance of the sensor.
Claviceps purpureaTrpES76LS76LdmaWdmaW which is a gene encoding dimethylallyltryptophan synthetase, wherein the inserted nucleotide sequence of the said at least one gene is under the control of a constitutive promoter. Furthermore, a method of production of such fungus is described, as well as an expression cassette for use in the said method.
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V.V.I. (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
Inventor
Veselovska, Lucia
Hocek, Michal
Hajduch, Marian
Dzubak, Petr
Abstract
Substituted pyridopyrrolopyrimidine ribonucleosides of general formula I, wherein R is as described in the independent claim, preferably R is selected from the group comprising thiophen-3-yl, furan-2-yl, furan-3-yl, benzofuran-2-yl, methylsulfanyl, methoxy, amino, dimethylamino, methyl; and pharmaceutically acceptable salt thereof, their optical isomers and mixtures of such optical isomers. Compounds according to the invention show strong cytostatic and cytotoxic effects on cell lines of tumor origin in a wide variety of diseases including tumors of different histogenetic origin.
C07H 19/23 - Heterocyclic radicals containing two or more heterocyclic rings condensed among themselves or condensed with a common carbocyclic ring system, not provided for in groups
A61P 35/04 - Antineoplastic agents specific for metastasis
57.
5-alkylthio-7-[(4-arylbenzyl)amino]-1(2)H-pyrazolo[4,3-d]pyrimidines for treatment of lymphoma
USTAV EXPERIMENTALNI BOTANIKY AV CR, V.V.I. (Czech Republic)
Inventor
Havlicek, Libor
Sturc, Antonin
Reznickova, Eva
Jorda, Radek
Krystof, Vladimir
Strnad, Miroslav
Abstract
5-alkylthio-7-[(4-arylbenzyl)amino]-1(2)H-pyrazolo[4,3-d]pyrimidine derivatives of formula I that are effective inhibitors of kinases and exhibit strong antiproliferative and proapoptotic properties on lymphoma cells. Derivatives in the treatment of blood hyperproliferative diseases, such as Non-Hodgkin lymphomas are also disclosed.
222 nanocavities are converted to TiN at 600 °C under ammonia flow. The resulting structure is an array of refractory (high-temperature stable) subwavelength TiN cylindrical cavities that operate as plasmonic nanofurnaces capable of reaching temperatures above 600 °C under moderate concentrated solar irradiation. The nanofurnaces show near-unity solar absorption in the visible and near infrared spectral ranges and a maximum thermoplasmonic solar-to-heat conversion efficiency of 68 percent.
The invention relates to heterocyclic nitrogen-containing purine derivatives, their use in the medicinal applications and compositions containing these derivatives. New generation of compounds possess selective antineurodegenerative properties on neuronal cells and tissues and can be particularly used in the treatment and prophylaxis of neurodegenerative disease, particularly in the treatment and prophylaxis of Parkinson's disease.
C07D 473/16 - Heterocyclic compounds containing purine ring systems with oxygen, sulfur, or nitrogen atoms directly attached in positions 2 and 6 two nitrogen atoms
6-disubstituted-9-(2-oxacycloalkyl)-9H-purine-2, 6-diamine derivatives and their use as drugs and cosmetics. The compounds of the present invention exhibit a number of biological activities associated with oxidative stress inhibition, especially anti-aging, anti-inflammatory and anti-neurodegenerative biological activities. The invention also relates to cosmetic and pharmaceutical compositions containing such derivatives as active agents.
C07D 473/16 - Heterocyclic compounds containing purine ring systems with oxygen, sulfur, or nitrogen atoms directly attached in positions 2 and 6 two nitrogen atoms
A61K 31/505 - PyrimidinesHydrogenated pyrimidines, e.g. trimethoprim
The present invention relates to novel 2,6-disubstituted-9-cyclopentyl-9H-purines of general formula I, capable of inhibiting the activity of kinases such as FLT3, CDKs and PDGFRs in cancer and other related proliferative diseases. The invention further includes pharmaceutical compositions containing the 2,6-disubstituted-9-cyclopentyl-9H-purines. Compounds of the present invention can be used as active ingredients of a pharmaceutical compositions for treating acute myeloid leukemia (AML).
Method for determination of identity of an entity from a mass spectrum of said entity, wherein said entity is a peptide, a protein, a .lipid, a nucleic acid, a metabolite or a molecule having a molecular weight of up to 2000 molig, and wherein for the entity, the method comprising the steps of: a) introducing the entity into a mass spectrometer and performing a mass spectrum measurement, b) collecting analytical data from mass spectrum of the entity, c) obtaining a plurality of candidate identities of the entity and obtaining prior probabilities of said candidate identities of the entity; d) for each candidate identity of an entity, calculation of its score, and e) determining the identity of the entity as the candidate identity with the score closest to the score which would correspond to a true identity of the entity.
G01N 33/483 - Physical analysis of biological material
G16B 20/00 - ICT specially adapted for functional genomics or proteomics, e.g. genotype-phenotype associations
G16B 40/00 - ICT specially adapted for biostatisticsICT specially adapted for bioinformatics-related machine learning or data mining, e.g. knowledge discovery or pattern finding
G16C 20/20 - Identification of molecular entities, parts thereof or of chemical compositions
G16C 20/70 - Machine learning, data mining or chemometrics
63.
METHOD OF IDENTIFICATION OF ENTITIES FROM MASS SPECTRA
The present invention relates to a method for determination of identity of at least one entity from a mass spectrum of said at least one entity and optionally from additional data from chemical, physical, biochemical or biological analysis of said at least one entity, for each entity comprising the steps of: a) collecting analytical data from mass spectrum of the entity, and optionally collecting additional analytical data from a chemical, physical, biochemical or biological analysis of the entity, b) obtaining a plurality of candidate identities of the entity and obtaining the prevalences of said candidate identities of the entity, whereas for each candidate identity it applies that all candidate identities with a higher prevalence are included in the plurality of candidate identities; c) for each candidate identity of an entity, calculation of its score, said calculation involving at least prevalence of entity, or at least prevalence of entity and agreement with mass spectrum, d) determining the identity of an entity as the candidate identity with the score closest to the score which would correspond to the true identity of the entity. The entity may be any chemical or biological entity, in particular a peptide, a protein, a lipid, a nucleic acid, a metabolite or a small molecule. The determination of the identity of the entity solves the problems of interpretation of mass spectra commonly encountered in shotgun proteomics and many other fields. The method of the present invention may be also used for determination of identity, in particular for authentication of cell lines or identification of an individual from mass spectra of proteome. The method may be also used for identification of non-host organism from mass spectra of proteome of host organism, in particular for diagnosis of microbial infection or colonization. The method may be also used for identification of presence of a tumour from mass spectra of body fluid proteins or estimation of tumour characteristics through presence or absence of somatic mutations. The method may be also used for monitoring of organ transplantation and early detection of transplant rejection from mass spectra of biological materials of recipient.
09 - Scientific and electric apparatus and instruments
Goods & Services
Computer software to enable the searching of data (as a tool for the support of HR-management in educational and research institutions); Computer databases (as a tool for the support of HR-management in educational and research institutions); Computer programmes for data processing (as a tool for the support of HR-management in educational and research institutions); Workforce management software; Computer software for time control; Data and file management and database software; Downloadable mobile application for testing to determine employment skills and employee screening and assessment tools; computer software for accessing, inputting, storing, processing and retrieving employment and career related information; computer software for evaluating job and career skills; Software relating to evaluation of employees.
09 - Scientific and electric apparatus and instruments
Goods & Services
Programs for computers; Software; Computer programs [downloadable software]; Computer software, recorded; Downloadable software applications; Testing software; Communication software; Computer software to enable the searching of data; Application software; Computer databases; Computer programmes for data processing; Downloadable mobile applications for the management of information; Workflow management system software; Workforce management software; Computer software for time control; Data and file management and database software; Workflow software; Downloadable mobile application for testing to determine employment skills and employee screening and assessment tools; computer software for accessing, inputting, storing, processing and retrieving employment and career related information; computer software for evaluating job and career skills; Software relating to evaluation of employees; Personnel tracking devices.
66.
15β-substituted estrone derivatives as selective inhibitors of 17β-hydroxysteroid-dehydrogenases, method of preparation and use thereof
A61K 31/566 - Compounds containing cyclopenta[a]hydrophenanthrene ring systemsDerivatives thereof, e.g. steroids not substituted in position 17 beta by a carbon atom, e.g. oestrane, oestradiol having an oxo group in position 17, e.g. oestrone
C07J 1/00 - Normal steroids containing carbon, hydrogen, halogen, or oxygen, not substituted in position 17 beta by a carbon atom, e.g. oestrane, androstane
The present invention provides 1-[1-(1-methylcyclooctyl)-4-piperidinyl]-2-[(3R)-3-piperidinyl]-1H-benzimidazole of formula for use in a method of treatment of a condition involving accumulation of senescent cells. The conditions involving accumulation of senescent cells are in particular cancer, cardiovascular, neurology and immune related diseases.
A61K 31/4545 - Non-condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems containing a six-membered ring with nitrogen as a ring hetero atom, e.g. pipamperone, anabasine
The invention refers to a method of measuring resistance of the resistive sensor (5), where the value of resistance of the resistive sensor (5) is determined from its series connection with actively controlled resistor network (3) with selectable value of resistance and with a periodic waveform voltage source (7), and further a device for measuring resistance of the resistive sensor (5) including a periodic waveform voltage source (7), actively controlled resistor network (3), and a resistive sensor (5), wherein the terminals of the periodic waveform voltage source (7) are connected to node A (2) and C (6), terminals of actively controlled resistor network (3) are connected to node A (2) and B (4), and terminals of the resistive sensor are connected to node B (4) and C (6), thus forming a connection in a resistive voltage divider with an automatic selection of one resistor of the divider, and usage of this method for measuring time-varying resistance of the sensor.
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V.V.I. (Czech Republic)
UNIVERZITA PALACKEHO V OLUMOUCI (Czech Republic)
Inventor
Veselovska, Lucia
Hocek, Michal
Hajduch, Marian
Dzubak, Petr
Abstract
Substituted pyridopyrrolopyrimidine ribonucleosides of general formula I, wherein R is as described in the independent claim, preferably R is selected from the group comprising thiophen-3-yl, furan-2-yl, furan-3-yl, benzofuran-2-yl, methylsulfanyl, methoxy, amino, dimethylamino, methyl; and pharmaceutically acceptable salt thereof, their optical isomers and mixtures of such optical isomers. Compounds according to the invention show strong cytostatic and cytotoxic effects on cell lines of tumor origin in a wide variety of diseases including tumors of different histogenetic origin.
C07H 19/23 - Heterocyclic radicals containing two or more heterocyclic rings condensed among themselves or condensed with a common carbocyclic ring system, not provided for in groups
70.
SUBSTITUTED PYRIDOPYRROLOPYRIMIDINE RIBONUCLEOSIDES FOR THERAPEUTIC USES
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V.V.I. (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
Inventor
Veselovska, Lucia
Hocek, Michal
Hajduch, Marian
Dzubak, Petr
Abstract
Substituted pyridopyrrolopyrimidine ribonucleosides of general formula I, wherein R is as described in the independent claim, preferably R is selected from the group comprising thiophen-3-yl, furan-2-yl, furan-3-yl, benzofuran-2-yl, methylsulfanyl, methoxy, amino, dimethylamino, methyl; and pharmaceutically acceptable salt thereof, their optical isomers and mixtures of such optical isomers. Compounds according to the invention show strong cytostatic and cytotoxic effects on cell lines of tumor origin in a wide variety of diseases including tumors of different histogenetic origin.
C07H 19/23 - Heterocyclic radicals containing two or more heterocyclic rings condensed among themselves or condensed with a common carbocyclic ring system, not provided for in groups
A61K 31/7052 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
USTAV EXPERIMENTALNI BOTANIKY AV CR, V.V.I. (Czech Republic)
Inventor
Havlicek, Libor
Sturc, Antonin
Reznickova, Eva
Jorda, Radek
Krystof, Vladimir
Strnad, Miroslav
Abstract
The present invention relates to 5-alkylthio-7-[(4-arylbenzyl)amino]-1(2)H-pyrazolo[4,3-d]pyrimidine derivatives of formula I which are effective inhibitors of kinases and exhibit strong antiproliferative and proapoptotic properties on lymphoma cells. This invention further relates to use of said derivatives in the treatment of blood hyperproliferative diseases, such as Non-Hodgkin lymphomas.
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V.V.I. (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
Inventor
Hocek, Michal
Tokarenko, Anna
Smolen, Sabina
Hajduch, Marian
Dzubak, Petr
Abstract
Substituted heteropentadieno-pyrrolopyrimidine ribonucleosides of general formula I, where R is selected from the group comprising furan-2-yl, furan-3-yl, benzofuran-2-yl, methylsulfanyl, methoxy, amino, dimethylamino, methyl or chloro, and pharmaceutically acceptable salt thereof, their optical isomers and mixtures of such optical isomers.
A61K 31/519 - PyrimidinesHydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
A61K 31/4985 - Pyrazines or piperazines ortho- or peri-condensed with heterocyclic ring systems
A61K 31/407 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with heterocyclic ring systems, e.g. ketorolac, physostigmine
A61K 31/341 - Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide not condensed with another ring, e.g. ranitidine, furosemide, bufetolol, muscarine
C07H 19/23 - Heterocyclic radicals containing two or more heterocyclic rings condensed among themselves or condensed with a common carbocyclic ring system, not provided for in groups
A61P 35/02 - Antineoplastic agents specific for leukemia
C07H 19/24 - Heterocyclic radicals containing oxygen or sulfur as ring hetero atom
73.
ADD-ON IMAGING MODULE FOR OFF-AXIS RECORDING OF POLARIZATION CODED WAVES
The invention relates to an add-on imaging module for the off-axis recording of polarization coded waves, that might be connected to any polarization adapted interferometric system, and which incorporates the first polarization sensitive beam splitter, the first optical system of the module and the detector, wherein the first optical system of the module includes the first imaging system and the linear polarizer.
The present invention provides a method of production of a barley plant producing at least one antimicrobial peptide, comprising the step of insertion of a nucleotide sequence containing - a sequence encoding an N-terminal signal peptide from a plant other than barley for translocation of a peptide through endoplasmatic reticulum, and - a sequence encoding at least one antimicrobial peptide selected from a group consisting of cathelicidins, defensins and magainins, into the genome of the barley plant. The invention further provides a suitable expression cassette, the resulting barley plant, and a method pro production of antimicrobial peptides using said barley plants.
C12N 15/82 - Vectors or expression systems specially adapted for eukaryotic hosts for plant cells
C07K 14/47 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans from vertebrates from mammals
75.
METHOD OF BREAST CANCER DIAGNOSTICS FROM A SAMPLE OF APOCRINE SWEAT
FAKULTNI NEMOCNICE HRADEC KRALOVE (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
Inventor
Zadak, Zdenek
Klemera, Petr
Hyspler, Radomir
Ticha, Alena
Adam, Tomas
Friedecky, David
Janeckova, Hana
Gardlo, Alzbeta
Karlikova, Radana
Abstract
The present invention provides a method of breast cancer diagnostics, in particular diagnostics of primary breast cancer, from a sample of apocrine sweat. This method determines the logarithm of the value expressing the amount of at least one marker in a sample of apocrine sweat taken from the patient's body, the marker being selected from a group of markers identified within the framework of the invention, and an evaluation of the logarithm of the value expressing the amount of the at least one marker in the sample of apocrine sweat in relation to logarithms of the values of this marker determined for persons suffering from breast cancer and for persons not suffering from breast cancer allows to make a diagnostic conclusion consisting in assigning the patient into the group of persons suffering from breast cancer, or the group of persons not suffering from breast cancer. The evaluation usually includes the use of mathematical-statistical methods.
The invention relates to N2,N6-disubstituted-9-(2-oxacycloalkyl)-9H-purine-2,6-diamine derivatives and their use as drugs and cosmetics. The compounds of the present invention exhibit a number of biological activities associated with oxidative stress inhibition, especially anti-aging, anti-inflammatory and anti-neurodegenerative biological activities. The invention also relates to cosmetic and pharmaceutical compositions containing such derivatives as active agents.
C07D 473/16 - Heterocyclic compounds containing purine ring systems with oxygen, sulfur, or nitrogen atoms directly attached in positions 2 and 6 two nitrogen atoms
Adenine derivatives substituted at the C2, N6, and N9 purine positions having antisenescent and combined photoprotective UVA/UVB effects. These substances are particularly suitable as anti-senescent and UV-photoprotective component in cosmetic preparations, plant protection preparations and in preparations for the treatment/application of tissue cultures.
C07D 473/34 - Nitrogen atom attached in position 6, e.g. adenine
C07D 473/40 - Heterocyclic compounds containing purine ring systems with halogen atoms or perhalogeno-alkyl radicals directly attached in position 2 or 6
A61K 8/49 - Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing heterocyclic compounds
A61Q 17/04 - Topical preparations for affording protection against sunlight or other radiationTopical sun tanning preparations
The present invention relates to novel 2,6-disubstituted-9-cyclopentyl-9H-purines of general formula I, capable of inhibiting the activity of kinases such as FLT3, CDKs and PDGFRs in cancer and other related proliferative diseases. The invention further includes pharmaceutical compositions containing the 2,6-disubstituted-9-cyclopentyl-9H-purines. Compounds of the present invention can be used as active ingredients of a pharmaceutical compositions for treating acute myeloid leukemia (AML).
: The present invention provides effervescent compositions, in particular for remediation of aqueous solutions, containing zero-valent iron particles, an acid in powder form, and an alkali metal bicarbonate or carbonate. Said compositions are easy to manufacture, cost effective, stable to store and highly active in remediation of pollutants, especially of heavy metals and organic compounds, from aqueous solutions by reduction. They can be combined with further components when other processes, e.g. absorption, are required for the optimal remediation ability.
The present solution relates to a device for facilitating the handling of solvents, mixtures and samples on carriers, which contains a holder, a lid, an insert and at least one tool, wherein: - the holder contains a sample part in the shape of basically a cylinder equipped with a recess for placing of the insert, wherein the lower part of the recess is equipped with at least one opening, and wherein the outer shell of the sample part of the holder is in at least one of its parts equipped with thread, and wherein the outer shape of the holder in this threaded part is basically a cylinder; - the insert is comprised of an outer part and an inner part, wherein the outer part of the insert is equipped with an opening for the inner part of the insert, the opening is connecting the opposite bases of the outer part of the insert, the inner part of the insert is equipped with at least one opening connecting its opposite bases, and wherein the outer shape of the outer part of the insert is adjusted to the size and the shape of the recess of the sample part of the holder, and the outer shape of the inner part of the insert is in at least a part of the inner part of the insert adjusted to the opening in the outer part of the insert and, at the same time, it is in at least a part of the inner part of the insert larger than the narrowest site of the opening in the outer part of the insert; - the lid contains a recess of the shape of basically a cylinder, wherein the inner shell of the recess of the lid is at least in one part equipped with thread compatible with the thread on the outer shell of the sample part of the holder, and wherein the part of the lid, which is opposite to the part of the lid containing the recess, is equipped with at least one opening, preferably circular; and wherein the part of the lid around the opening(s) in the lid in the area facing the recess of the lid, is in at least some of its parts larger than the ground plan of the outer part of the insert and/or of the tools placed in the device; - the tool is adjusted in shape and size for insertion into the sample part of the holder, and the tool is selected from the group comprising filters, supports, seals, separation parts, sample carriers or combination thereof. The present invention further relates to a set for handling of solvents, mixtures and samples on carriers, and to the use thereof.
The present invention relates to a mucoadhesive carrier or drug delivery system, which comprises nanoscaffold having a nanofibrous layer with a thickness of from 0.1 to 1000 µm, carrying the active substance in the form of particles. The mucoadhesive layer, in at least a part of its surface, overlaps the nanoscaffold so that it can adhere to the mucosa. A process for its preparation (the nanofibres are formed by electrospinning) and its use for delivery of the vaccines and therapeutics to mucosal surfaces is also disclosed.
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V.V.I. (Czech Republic)
Inventor
Hocek, Michal
Tokarenko, Anna
Smolen, Sabina
Hajduch, Marian
Dzubak, Petr
Abstract
Substituted heteropentadieno-pyrrolopyrimidine ribonucleosides of general formula (I), where R is selected from the group comprising furan-2-yl, furan-3-yl, benzofuran-2-yl, methylsulfanyl, methoxy, amino, dimethylamino, methyl or chloro, and pharmaceutically acceptable salt thereof, their optical isomers and mixtures of such optical isomers. Compounds according to the invention show strong cytostatic and cytotoxic effects on cell lines in a wide variety of diseases including tumors of various histogenic origin.
A61K 31/7064 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
A61P 35/02 - Antineoplastic agents specific for leukemia
C07H 19/23 - Heterocyclic radicals containing two or more heterocyclic rings condensed among themselves or condensed with a common carbocyclic ring system, not provided for in groups
84.
SUBSTITUTED HETEROPENTADIENO-PYRROLOPYRIMIDINE RIBONUCLEOSIDES FOR THERAPEUTIC USE
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V.V.I. (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
Inventor
Hocek, Michal
Tokarenko, Anna
Smolen, Sabina
Hajduch, Marian
Dzubak, Petr
Abstract
Substituted heteropentadieno-pyrrolopyrimidine ribonucleosides of general formula (I), where R is selected from the group comprising furan-2-yl, furan-3-yl, benzofuran-2-yl, methylsulfanyl, methoxy, amino, dimethylamino, methyl or chloro, and pharmaceutically acceptable salt thereof, their optical isomers and mixtures of such optical isomers. Compounds according to the invention show strong cytostatic and cytotoxic effects on cell lines in a wide variety of diseases including tumors of various histogenic origin.
C07H 19/23 - Heterocyclic radicals containing two or more heterocyclic rings condensed among themselves or condensed with a common carbocyclic ring system, not provided for in groups
A61K 31/7064 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V.V.I. (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
Inventor
Hocek, Michal
Tichy, Michal
Hajduch, Marian
Dzubak, Petr
Abstract
Substituted thienopyrrolopyrimidine ribonucleosides for therapeutic use The invention provides a new group of substituted thienopyrrolopyrimidine ribonucleosides of general formula I, wherein R is defined in the claims. The compounds of this invention show strong cytostatic and cytotoxic activities preferably against cancer cell lines of broad spectrum of diseases including tumors of various histogenetic origin.
USTAV ORGANICKE CHEMIE A BIOCHEMIE AV CR, V.V.I. (Czech Republic)
USTAV MOLEKULARNI GENETIKY AKADEMIE VED CR, V.V.I. (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
HELMHOLTZ ZENTRUM MÜNCHEN (Germany)
Inventor
Kotora, Martin
Prchalova, Eva
Adamski, Jerzy
Moller, Gabriele
Stepanek, Ondrej
Bartunek, Petr
Sedlak, David
Hajduch, Marian
Dzubak, Petr
Abstract
15β-substituted derivatives of estrone of general formula I wherein R1, R2, R3, R4, R5 are independently selected from the group consisting of: C1-C4 alkyl, C1-C4 alkoxy, C1-C4 halogenalkyl, halogen, COOR6 wherein R6 is C1-C4 alkyl; H, OH; optionally, R3, R4 and R5 are each formed by a hydrogen atom, while R1 and R2 together form an aryl group, preferably naphthyl; wherein the aromatic ring in position C-15 can be mono-, di-, tri-, tetra- and penta- substituted with substituents R1-R5. Compounds of the invention may be used for diagnosis and possibly also for the treatment of estrogen-dependent diseases.
C07J 1/00 - Normal steroids containing carbon, hydrogen, halogen, or oxygen, not substituted in position 17 beta by a carbon atom, e.g. oestrane, androstane
A61K 31/566 - Compounds containing cyclopenta[a]hydrophenanthrene ring systemsDerivatives thereof, e.g. steroids not substituted in position 17 beta by a carbon atom, e.g. oestrane, oestradiol having an oxo group in position 17, e.g. oestrone
6-aryl-9-glycosidpurines of general formula I
Ar represents benzyl or furfuryl, each of which can be unsubstituted or substituted by one or more, preferably one to three, substituents selected from the group comprising hydroxyl, alkyl, halogen, alkoxy, amino, mercapto, carboxyl, cyano, amido, sulfo, sulfamido, acyl, acylamino, acyloxy, alkylamino, dialkylamino, alkylmercapto, trifluoromethyl, trifluoromethoxy, for use as antisenescent and UV protective compounds in animals.
A61K 31/7076 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid
A61Q 17/04 - Topical preparations for affording protection against sunlight or other radiationTopical sun tanning preparations
Substituted 1,2,3-thiadiazol-5yl-urea derivatives, their use as anti-senescence and anti-stress factors of plant cells, organs and the whole plant, and preparations containing these derivatives.
A01N 47/36 - Ureas or thioureas containing the groups N—CO—N or N—CS—N containing the group N—CO—N directly attached to at least one heterocyclic ringThio-analogues thereof
C07D 417/12 - Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group containing two hetero rings linked by a chain containing hetero atoms as chain links
A01N 25/08 - Biocides, pest repellants or attractants, or plant growth regulators, characterised by their forms, or by their non-active ingredients or by their methods of applicationSubstances for reducing the noxious effect of the active ingredients to organisms other than pests containing solids as carriers or diluents
A01N 25/22 - Biocides, pest repellants or attractants, or plant growth regulators, characterised by their forms, or by their non-active ingredients or by their methods of applicationSubstances for reducing the noxious effect of the active ingredients to organisms other than pests containing ingredients stabilising the active ingredients
A01N 25/30 - Biocides, pest repellants or attractants, or plant growth regulators, characterised by their forms, or by their non-active ingredients or by their methods of applicationSubstances for reducing the noxious effect of the active ingredients to organisms other than pests characterised by the surfactants
A01N 25/02 - Biocides, pest repellants or attractants, or plant growth regulators, characterised by their forms, or by their non-active ingredients or by their methods of applicationSubstances for reducing the noxious effect of the active ingredients to organisms other than pests containing liquids as carriers, diluents or solvents
89.
IODINATED ANALOGS OF CHOLINE, METHODS OF PREPARATION THEREOF, AND USE THEREOF AS MEDICAMENTS
The invention relates to iodinated aromatic choline analogs of general formula wherein at least one R is iodine; the quaternary ammonium group comprises a hydroxyl substituent, and further substituent are as defined in the claims. The compounds of the invention can be used in medicine as imaging agents and therapeutics, in particular in oncologic, inflammatory and neurological disorders.
C07D 453/02 - Heterocyclic compounds containing quinuclidine or iso-quinuclidine ring systems, e.g. quinine alkaloids containing not further condensed quinuclidine ring systems
C07D 295/073 - Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by halogen atoms or nitro radicals with the ring nitrogen atoms and the substituents separated by carbocyclic rings or by carbon chains interrupted by carbocyclic rings
C07D 295/084 - Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by singly bound oxygen or sulfur atoms with the ring nitrogen atoms and the oxygen or sulfur atoms attached to the same carbon chain, which is not interrupted by carbocyclic rings
C07D 213/65 - One oxygen atom attached in position 3 or 5
The invention provides a method of in-vitro determination of diagnosis and/or prognosis and/or prediction of therapeutic response of a neoplastic disease or a pre-neoplastic disease from a sample taken from a body of a patient, said method comprising a step of determination of presence, and optionally amount, of a peptide containing a 9 amino acid sequence SATVNLTVI, said peptide being optionally post-translationally modified, in said sample, and subsequently a step of making the diagnosis and/or prognosis and/or prediction of therapeutic response. The peptide is a specific marker indicative of the presence of the IGSF5 protein.
The present invention provides adenine derivatives substituted at the C2, N6, and N9 purine positions having antisenescent and combined photoprotective UVA / UVB effects. These substances are particularly suitable as anti-senescent and UV-photoprotective component in cosmetic preparations, plant protection preparations and in preparations for the treatment/application of tissue cultures.
C07D 473/00 - Heterocyclic compounds containing purine ring systems
C07D 473/40 - Heterocyclic compounds containing purine ring systems with halogen atoms or perhalogeno-alkyl radicals directly attached in position 2 or 6
A01N 1/00 - Preservation of bodies of humans or animals, or parts thereof
The planar irradiation source especially for induction and monitoring of photodynamic effect in vitro in samples placed in a bed (3) which is formed with a sealable body (1 ) which is procured with a from above opened central chamber (11 ) modified not only for removable insertion of the bed (3) with analyzed sample but also for above it positioned removable positioning of a semitransparent thin walled irradiation plate (4) which is procured with diode chips (41 ) placed in the rows with mutual hexagonal arrangement whereas the diode chips (41 ) are in parallel connected with a bus (42), which is led along the perimeter of the irradiation plate (4) and is connected with an external power supply, and are placed in the irradiation plate (4) in the way that their light beams are directed straight down toward the bed (3).
The invention provides a system for verification of product authenticity, containing: - a first DNA strand containing a first molecule active in Surface–Enhanced Raman Scattering, bound in a region of one of the ends of the DNA strand, and - a second DNA strand comprising in a region of a first end of the DNA strand a functional group containing sulphur or nitrogen atom, and in a region of a second end of the DNA strand a second molecule active in Surface–Enhanced Raman Scattering, whereas the second DNA strand is bound to the surface of a noble metal nanoparticle via its functional group containing sulphur or nitrogen atom, and whereas the second molecule active in Surface–Enhanced Raman Scattering is different from the first molecule active in Surface–Enhanced Raman Scattering, and whereas the first DNA strand and the second DNA strand are, in at least a part of their length, mutually complementary. The invention further relates to a method for verification of product authenticity, based on the above described system.
C12Q 1/68 - Measuring or testing processes involving enzymes, nucleic acids or microorganismsCompositions thereforProcesses of preparing such compositions involving nucleic acids
94.
DEVICE FOR MAGNETIC SEPARATION OF FERROMAGNETIC PARTICLES, KIT FOR MAGNETIC SEPARATION OF THE PARTICLES, METHOD OF SEPARATION OF MAGNETIC PARTICLES FROM A SOLUTION AND USE THEREOF
The subject of the invention is a device for magnetic separation of ferromagnetic particles from solutions, which contains a magnet (1) and a separation vessel holder (6), wherein the separation vessel holder is placed in such a way towards the magnet that each separation vessel (A) would, upon its placement in the separation vessel holder, be located by the area of its wall, whereon the separation is to take place, close to an edge of the north or the south pole of the magnet, whereas the distance of any other part of the separation vessel from an edge of the opposite pole of the magnet is always greater than the distance between the areas of the wall, whereon the separation is to take place, and the edge of the pole of the magnet serving for the separation. The subject of the invention is also a kit for magnetic separation of particles, containing the device for the magnetic separation of ferromagnetic particles from solutions and at least one separation vessel. The invention also relates to a method of separation of magnetic particles from a solution and to the use of the device for the separation of ferromagnetic particles from a solution, mixture or suspension.
The invention provides a method of preparation of barley plants resistant to drought, wherein a nucleotide sequence is inserted into the barley genome, said nucleotide sequence containing a sequence with at least 80% identity to the sequence of the gene AtCKX1 from the plant Arabidopsis thaliana. The invention further provides an expression cassette which contains promoter-AtCKX1-terminator, and use of this expression cassette for the preparation of barley plants showing resistance to drought.
USTAV EXPERIMENTALNI BOTANIKY AV CR, V.V.I. (Czech Republic)
UNIVERZITA PALACKEHO V OLOMOUCI (Czech Republic)
Inventor
Zahajska, Lenka
Nisler, Jaroslav
Kadlecova, Alena
Zatloukal, Marek
Gruz, Jiri
Voller, Jiri
Dolezal, Karel
Strnad, Miroslav
Abstract
6,8-Disubstituted-9-(heterocyclyl) purines which can be used in pharmaceutical and cosmetic compositions and/or applications are provided. These 6,8-disubstituted-9-(heterocyclyl) purines have a wide range of biological activities, including for example antioxidant, anti-inflammatory, anti-senescent, as well as well as other activities which are especially useful in pharmaceutical and cosmetic applications.
The invention relates to substituted 6-anilino-9-heterocyclylpurine derivatives of formula (I) wherein R denotes one to five substituents independently selected from the group comprising hydrogen, halogen, hydroxy, amino, alkyloxy and alkyl group, R2 is selected from the group comprising amino, halogen, hydroxy, thio, and alkylthio group, Cyc is five- or six-membered heterocyclic ring containing one oxygen atom. Said derivatives are useful for inhibition of plant stress.
C07D 473/16 - Heterocyclic compounds containing purine ring systems with oxygen, sulfur, or nitrogen atoms directly attached in positions 2 and 6 two nitrogen atoms
A01N 43/713 - Biocides, pest repellants or attractants, or plant growth regulators containing heterocyclic compounds having rings with four or more nitrogen atoms as the only ring hetero atoms
A01N 43/90 - Biocides, pest repellants or attractants, or plant growth regulators containing heterocyclic compounds having two or more relevant hetero rings, condensed among themselves or with a common carbocyclic ring system
C07D 473/34 - Nitrogen atom attached in position 6, e.g. adenine
The present invention provides 6-aryl-9-glycosidpurines of general formula I and pharmaceutically acceptable salts thereof with alkali metals, ammonia, amines, or addition salts with acids, wherein Gly represents β-D-arabinofuranosyl or β-D-2´-deoxyribofuranosyl, Ar represents benzyl or furfuryl, each of which can be unsubstituted or substituted by one or more, preferably one to three, substituents selected from the group comprising hydroxyl, alkyl, halogen, alkoxy, amino, mercapto, carboxyl, cyano, amido, sulfo, sulfamido, acyl, acylamino, acyloxy, alkylamino, dialkylamino, alkylmercapto, trifluoromethyl, trifluoromethoxy, for use for regulation, in particular inhibition, of aging in plants in vivo or plant cells in vitro, and for regulation of growth and development of plants in vivo, plant tissues, plant organs and plant cells in vitro..
A61K 31/7076 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid
C07H 19/173 - Purine radicals with 2-deoxyribosyl as the saccharide radical
C07H 19/19 - Purine radicals with arabinosyl as the saccharide radical
The present invention provides 6-aryl-9-glycosidpurines of general formula I and pharmaceutically acceptable salts thereof with alkali metals, ammonia, amines, or addition salts with acids, wherein Gly represents β-D-arabinofuranosyl or β-D-2´-deoxyribofuranosyl, Ar represents benzyl or furfuryl, each of which can be unsubstituted or substituted by one or more, preferably one to three, substituents selected from the group comprising hydroxyl, alkyl, halogen, alkoxy, amino, mercapto, carboxyl, cyano, amido, sulfo, sulfamido, acyl, acylamino, acyloxy, alkylamino, dialkylamino, alkylmercapto, trifluoromethyl, trifluoromethoxy, for use as antisenescent and UV protective compounds in animals.
A61K 31/7076 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid
C07H 19/173 - Purine radicals with 2-deoxyribosyl as the saccharide radical
C07H 19/19 - Purine radicals with arabinosyl as the saccharide radical
The portable hyperbaric mini-chamber formed with a vessel (1) whose body (11) is modified for a hermetic sealing with the lid (2) by the help of the locking mechanism (5) and is equipped with sealable grommets (112) for provision of connection of the inner space (3) of the mini-chamber with outer environment, where the essence of the invention consists in the fact that in the front part (22) of the lid (2) is fixed the upper cover (4) which is procured with at least one upper eye-slit (41) into the inner space (3) of the mini-chamber, the bottom (12) of the vessel (1) is procured with a technological opening (121) which is fitted with the lower cover (7) which forms the lower eye-slit (71) into the inner space (3) of the mini-chamber where the upper eye-slit (41) as well as the lower slit (71) are made of a transparent material, whereas at least one grommet (112) is fitted with the port (93) of the input pipeline (94) of a pressure working medium and at least one grommet (112) is fitted with the port (93) of the output pipeline (96) which is procured with the safety valve (961).
A61G 10/02 - Treatment rooms for medical purposes with artificial climateTreatment rooms for medical purposes with means to maintain a desired pressure, e.g. for germ-free rooms
