The present invention pertains to anti-LYPD3 antibodies which bind LYPD3 in an O- glycosylation-dependent manner. Thereby, the antibodies are specific for tumor- associated LYPD3. The invention further provides pharmaceutical compositions containing said anti-LYPD3 antibodies and their use in cancer treatment.
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
C07K 16/44 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere
A61K 47/68 - Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additivesTargeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
The present invention pertains to humanized anti-Lewis Y antibodies which specifically bind to Lewis Y and do not show any cross-reactivity. Especially, the humanized anti-Lewis Y antibodies do not bind to Lewis b or any other blood group carbohydrate antigen. In particular, the present invention is directed to humanized anti-Lewis Y antibodies which are useful in the treatment of cancer.
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
The present disclosure pertains to novel antibodies directed against the cancer antigen MUC1. In particular, an antibody with improved antigen binding was obtained by deleting a glycosylation site in the CDR-H2 of a known anti-MUC1 antibody.
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
A61K 47/68 - Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additivesTargeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
A61P 35/02 - Antineoplastic agents specific for leukemia
A61K 39/395 - AntibodiesImmunoglobulinsImmune serum, e.g. antilymphocytic serum
4.
Fusion Protein Constructs Comprising an Anti-MUC1 Antibody and IL-15
The present invention pertains to fusion protein constructs comprising an antibody against the cancer antigen MUC1 and IL-15. In particular, the fusion protein constructs activate NK cells and T cells at the cancer site.
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
Some embodiments of the methods and compositions provided herein relate to the preparation surfactant protein-D (SP-D). Some embodiments include the expression of human SP-D in certain cell lines, and the purification of human SP-D from such cell lines. Some embodiments include the preparation of certain oligomeric forms of human SP-D.
The present disclosure pertains to novel antibodies directed against the cancer antigen MUC1. In particular, an antibody with improved antigen binding was obtained by deleting a glycosylation site in the CDR-H2 of a known anti-MUCl antibody.
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
The present disclosure pertains to novel antibodies directed against the cancer antigen MUC1. In particular, an antibody with improved antigen binding was obtained by deleting a glycosylation site in the CDR-H2 of a known anti-MUCl antibody.
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
8.
FUSION PROTEIN CONSTRUCTS COMPRISING AN ANTI-MUC1 ANTIBODY AND IL-15
The present invention pertains to fusion protein constructs comprising an antibody against the cancer antigen MUC1 and IL-15. In particular, the fusion protein constructs activate NK cells and T cells at the cancer site.
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
The present invention pertains to fusion protein constructs comprising an antibody against the cancer antigen MUC1 and IL-15. In particular, the fusion protein constructs activate NK cells and T cells at the cancer site.
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
Some embodiments of the methods and compositions provided herein relate to the preparation surfactant protein-D (SP-D). Some embodiments include the expression of human SP-D in certain cell lines, and the purification of human SP-D from such cell lines. Some embodiments include the preparation of certain oligomeric forms of human SP-D.
A61K 38/17 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans
A61P 11/00 - Drugs for disorders of the respiratory system
C07K 14/47 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans from vertebrates from mammals
Some embodiments of the methods and compositions provided herein relate to the preparation surfactant protein-D (SP-D). Some embodiments include the expression of human SP-D in certain cell lines, and the purification of human SP-D from such cell lines. Some embodiments include the preparation of certain oligomeric forms of human SP-D.
A61P 11/00 - Drugs for disorders of the respiratory system
C07K 14/00 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof
C07K 14/435 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans
Some embodiments of the methods and compositions provided herein relate to the preparation surfactant protein-D (SP-D). Some embodiments include the expression of human SP-D in certain cell lines, and the purification of human SP-D from such cell lines. Some embodiments include the preparation of certain oligomeric forms of human SP-D.
01 - Chemical and biological materials for industrial, scientific and agricultural use
05 - Pharmaceutical, veterinary and sanitary products
09 - Scientific and electric apparatus and instruments
Goods & Services
Chemical and microbiological products for laboratory
analyses, also in the form of kits, except for medical or
veterinary purposes; chemical and microbiological products
for industrial and scientific purposes, especially products
for the analysis of carbohydrates, also in the form of kits,
except for medical or veterinary purposes; diagnostic
agents, except for medical or veterinary purposes. Chemical and microbiological preparations for pharmaceutical
purposes, especially preparations for diagnostic purposes,
also in the form of kits; chemical and microbiological
products for laboratory analyses for medical purposes, also
in the form of kits; diagnostic agents for medical purposes. Computer programs, especially computer programs for
evaluating laboratory analyses; computer software;
databases.
The present invention relates to an antibody which effects enhanced T cell activation in comparison to a reference antibody being glycosylated including more than 80% core-fucosylation and wherein T cell activation is effected by an antibody characterized by enhanced binding to Fc?RIIIa.Said antibody is glycosylated, but essentially lacks core-fucosylation.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
The present invention pertains to humanized anti-CD40 antibodies having antigen binding properties similar to those of the parent chimeric anti-CD40 antibody and increased Fcγ receptor binding affinities. In particular, the present invention is directed to humanized anti-CD40 antibodies which are useful in the treatment of cancer, infections and immunodeficiencies.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
16.
MULTISPECIFIC ANTIBODY CONSTRUCTS BINDING TO MUC1 AND CD3
The present invention pertains to multispecific antibody constructs directed against the cancer antigen MUC1 and the T cells antigen CD3. In particular, the multispecific antibody constructs recruit T cells to the cancer site. The design of the multispecific antibody constructs show strong antigen binding and high T cell activation.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
C07K 16/32 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products from oncogenes
The present invention relates to an antibody which effects enhanced T cell activation in comparison to a reference antibody being glycosylated including more than 80% core-fucosylation and wherein T cell activation is effected by an antibody characterized by enhanced binding to FcRIIIa.Said antibody is glycosylated, but essentially lacks core-fucosylation.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
The present invention relates to a bispecific antibody comprising a first binding domain capable of binding to a first target and a second binding domain capable of binding to a second target, wherein (i) said second binding domain comprises a VH and a VLdomain capable of binding a second target and wherein (ii) said first binding domain comprises a single chain Fv region capable of binding a first target, which is coupled to the constant domain of the light chain of said second binding domain.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
The present invention pertains to the field of cancer therapy using anti-cancer antibodies. The medical use of anti-MUC1 antibodies in combination with inhibitors of the ErbB receptor family is provided which show synergistic anti-cancer efficacy.
A61K 39/395 - AntibodiesImmunoglobulinsImmune serum, e.g. antilymphocytic serum
A61K 47/55 - Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additivesTargeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug, i.e. a dimer, oligomer or polymer of pharmacologically or therapeutically active compounds
A61K 47/68 - Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additivesTargeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
21.
ANTI-CANCER TREATMENTS WITH AN ANTI-MUC1 ANTIBODY AND AN ERBB INHIBITOR
The present invention pertains to the field of cancer therapy using anti-cancer antibodies. The medical use of anti-MUC1 antibodies in combination with inhibitors of the ErbB receptor family is provided which show synergistic anti-cancer efficacy.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
A61K 39/00 - Medicinal preparations containing antigens or antibodies
22.
SERUM-FREE CULTIVATION OF PROGENITOR DENDRITIC CELLS
The invention relates to a method for the serum-free cultivation of progenitor cell lines for dendritic cells comprising culturing said cell lines in serum-free cell culture and to progenitor cell lines for dendritic cells obtainable by said method. The invention also provides methods for differentiating said progenitor cells into dendritic cells and to dendritic cells obtainable from said progenitor cell lines through differentiation as well as to a vaccine composition comprising said dendritic cells.
A61K 35/15 - Cells of the myeloid line, e.g. granulocytes, basophils, eosinophils, neutrophils, leucocytes, monocytes, macrophages or mast cellsMyeloid precursor cellsAntigen-presenting cells, e.g. dendritic cells
A61K 39/00 - Medicinal preparations containing antigens or antibodies
23.
Eukaryotic expression vectors comprising regulatory elements of the globin gene clusters
The present invention pertains to the field of recombinant protein production. Novel expression cassettes comprising elements of the human globin gene clusters are provided which show enhanced expression rates of proteins or polypeptides of interest.
C12P 21/02 - Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
C12N 15/85 - Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
C07K 14/47 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans from vertebrates from mammals
C12N 15/66 - General methods for inserting a gene into a vector to form a recombinant vector using cleavage and ligationUse of non-functional linkers or adaptors, e.g. linkers containing the sequence for a restriction endonuclease
G01N 33/50 - Chemical analysis of biological material, e.g. blood, urineTesting involving biospecific ligand binding methodsImmunological testing
The present invention relates to a method of modifying at least one gene in a cell via CRISPR/Cas, wherein the at least one gene has at least three alleles. The present invention further relates to cells obtainable by the method of the invention. Additionally, the present invention provides a method of producing a protein in a cell obtainable by the method of modifying at least one gene of the invention. Moreover, the invention relates to proteins obtainable by the method of producing a protein and use thereof, for example in therapy.
The present invention pertains to IgA antibodies having an optimized glycosylation pattern. These IgA antibodies exhibit an increased stability and an extended shelf life. Compositions comprising IgA antibodies having an improved glycosylation pattern and methods for improving the shelf life of IgA antibodies are provided.
C07K 16/00 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
C07K 16/32 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products from oncogenes
26.
MAMMALIAN FOLLICLE-STIMULATING HORMONE COMPOSITION WITH INCREASED STABILITY
The present invention pertains to the field of gonadotropins. In particular, an improved composition comprising recombinant human follicle-stimulating hormone and chlorocresol is provided. This improved composition has an increased stability at high temperatures and is useful in the treatment of infertility, in particular in human patients.
The present invention pertains to fusion constructs of dimeric enzymes or dimeric complexes comprising one or more enzymes, wherein the portions of the protein or complex are fused to either to dimerization units. These fusion constructs improve stability, solubility, circulation half-life and production yield of the dimeric enzymes and complexes.
The present invention pertains to improved factor VII preparations which have a superior glycosylation pattern. These improved factor VII preparations can be used in the treatment of bleeding disorders.
The present invention pertains to fusion constructs of dimeric proteins, wherein the portions of the protein are fused to either to the CH1 domain of the CL domain of an antibody. These fusion constructs improve stability, solubility, circulation half-life and production yield of the dimeric protein.
The present invention relates to a process for the purification of a γ-carboxylated polypeptide such as Factor VII, comprising subjecting a liquid containing said γ-carboxylated polypeptide to the steps of affinity chromatography and multimodal anion exchange chromatography. Also provided is a manufacturing process for producing a γ-carboxylated polypeptide of interest.
The present invention pertains to methods for producing a γ-carboxylated polypeptide by a host cell having γ-glutamyl carboxylase activity. The production is improved by the presence of vitamin K and cyclodextrin in the cell culture medium.
The present invention pertains to the field of cell cultivation. Small scale cell culture systems are provided which simulate large scale perfusion cultures of suspension cells. The present invention in particular provides methods for cultivating cells wherein cell sedimentation is used to separate cells from culture medium for replacing part of the culture medium.
The present invention pertains to the field of recombinant protein production. Novel expression cassettes comprising elements of the human globin gene clusters are provided which show enhanced expression rates of proteins or polypeptides of interest.
The present invention pertains to the field of recombinant protein production. Novel expression cassettes comprising elements of the human globin gene clusters are provided which show enhanced expression rates of proteins or polypeptides of interest.
The present invention relates to antibody-drug conjugates (ADCs) and a method for improving the safety profile of the same, comprising linking an antibody molecule to a drug in order to obtain said ADC, wherein said antibody molecule is obtainable from a host cell selected to produce an antibody molecule composition having specific glycosylation characteristics.
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
C07K 16/32 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products from oncogenes
A61K 47/48 - Medicinal preparations characterised by the non-active ingredients used, e.g. carriers, inert additives the non-active ingredient being chemically bound to the active ingredient, e.g. polymer drug conjugates
The invention relates to a method for detecting nucleic acid in samples which contain biological material, and to a kit which enables the detection method to be carried out with the components thereof For example, said detection method is suitable to detect in said type of samples, which contain biotechnologically produced biological material, nucleic acids of host cells which have been used to produce the material.
01 - Chemical and biological materials for industrial, scientific and agricultural use
05 - Pharmaceutical, veterinary and sanitary products
42 - Scientific, technological and industrial services, research and design
Goods & Services
(1) Chemicals used in industry and science, namely chemicals used for preparation, engineering, storage and analysis of organic compounds, biological compounds, proteins, peptides, engineered proteins and peptides, glycoproteins, antibodies, antigens, nucleic acids, saccharides, cells and microorganisms; unprocessed artificial resins; unprocessed plastics; fertilising preparations; chemical substances for fermenting and preserving food stuffs; tanning agents for use in the manufacture of leather; bacteria and cell preparations and elements, fragments, fractions and lysates thereof, except for medical or veterinary purposes, namely for use in protein production, food manufacturing, scientific research; preparations containing bacteria and cells, except for medical or veterinary purposes, namely, for use in protein production, food manufacturing, scientific research, waste water treatment; biological preparations for laboratories, except for medical or veterinary purposes, namely for use in bacterial and cell engineering, cultivation, harvesting, protein production; chemical preparations for analysis in laboratories, namely, preparations for analysis of proteins, peptides, engineered proteins and peptides, glycoproteins, glycosylation, antibodies or antigens, preparations comprising antibody reagents used for the detection of antigens; chemical preparations for scientific purposes, namely, preparations for preparation, engineering, storage or analysis of proteins, peptides, engineered proteins and peptides, glycoproteins, glycosylation, antibodies, antigens, nucleic acids, saccharides, cells and microorganisms; chemical and biological reagents in the nature of reagents for use in protein production, bacterial and cell engineering, cultivation and harvesting; in vitro diagnostic preparations, except for medical or veterinary purposes; enzymes, proteins and respective preparations for industrial purposes, namely engineered proteins, glycosylated proteins, antibodies, enzymes for use in glycosylation, enzyme substrates, proteins used in the manufacture of cosmetics, beverages, food products and food supplements; in vitro diagnostic reagents, other than for medical purposes, namely for use in biochemistry, clinical chemistry and microbiology; cultures of microorganisms and cells and elements, fragments, fractions and lysates thereof, other than for medical or veterinary purposes, namely for use in protein production, food manufacturing, scientific research; expression systems for proteins and peptides, particularly on the basis of cells, particularly human cells and microorganisms, namely, expression systems for engineered or glycosylated proteins or peptides, expression systems with optimized glycosylation activity; milk ferments for chemical purposes.
(2) Pharmaceutical and veterinary preparations, namely for prophylaxis or treatment of cancer, atherosclerosis, arthritis, inflammatory bowel diseases, dermatitis, systemic inflammatory response syndrome, encephalitis, meningitis, autoimmune diseases, allergies, cardiovascular diseases, herpes, hepatitis, AIDS, respiratory infections, gastrointestinal infection, sepsis, tuberculosis, malaria, measles, meningitis, influenza, poliomyelitis, Alzheimer's disease, Parkinson's disease, cerebral palsy, multiple sclerosis, amyotrophic lateral sclerosis, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and treatment of infertility; dietetic sugar for medical use; food for babies; materials for dressings, namely wound dressings, burn dressings, surgery dressings; materials for dental filling, namely fillings for teeth, and impression materials for dental purposes; preparations for destroying vermin; fungicides, herbicides; medicines for human and veterinary purposes, namely for prophylaxis or treatment of cancer, atherosclerosis, arthritis, inflammatory bowel diseases, dermatitis, systemic inflammatory response syndrome, encephalitis, meningitis, autoimmune diseases, allergies, cardiovascular diseases, herpes, hepatitis, AIDS, respiratory infections, gastrointestinal infection, sepsis, tuberculosis, malaria, measles, meningitis, influenza, poliomyelitis, Alzheimer's disease, Parkinson's disease, cerebral palsy, multiple sclerosis, amyotrophic lateral sclerosis, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and treatment of infertility; dietetic food adapted for medical purposes comprising enzymes, proteins, peptides, glycoproteins, antibodies, saccharides, cells, microorganisms for prophylaxis or treatment of cancer, atherosclerosis, arthritis, inflammatory bowel diseases, dermatitis, systemic inflammatory response syndrome, encephalitis, meningitis, autoimmune diseases, allergies, cardiovascular diseases, herpes, hepatitis, AIDS, respiratory infections, gastrointestinal infection, sepsis, tuberculosis, malaria, measles, meningitis, influenza, poliomyelitis, Alzheimer's disease, Parkinson's disease, cerebral palsy, multiple sclerosis, amyotrophic lateral sclerosis, gastrointestinal diseases and for use in wound healing, formation of blood and tissue and treatment of infertility; enzymes, proteins, antibodies, cells, microorganisms as well as fragments, fractions, elements and lysates thereof for medical purposes for prophylaxis or treatment of cancer, atherosclerosis, arthritis, inflammatory bowel diseases, dermatitis, systemic inflammatory response syndrome, encephalitis, meningitis, autoimmune diseases, allergies, cardiovascular diseases, herpes, hepatitis, AIDS, respiratory infections, gastrointestinal infection, sepsis, tuberculosis, malaria, measles, meningitis, influenza, poliomyelitis, Alzheimer's disease, Parkinson's disease, cerebral palsy, multiple sclerosis, amyotrophic lateral sclerosis, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and treatment of infertility, and as nutritional additives in the manufacture of dietetic food adapted for medical purposes and dietary supplements for human consumption; vaccines for prophylaxis or treatment of cancer, atherosclerosis, arthritis, inflammatory bowel diseases, dermatitis, systemic inflammatory response syndrome, encephalitis, meningitis, autoimmune diseases, allergies, cardiovascular diseases, herpes, hepatitis, AIDS, respiratory infections, gastrointestinal infection, sepsis, tuberculosis, malaria, measles, meningitis, influenza, poliomyelitis, Alzheimer's disease, Parkinson's disease, cerebral palsy, multiple sclerosis, amyotrophic lateral sclerosis, gastrointestinal diseases; carbohydrates for medical purposes, namely for prophylaxis or treatment of cancer, atherosclerosis, arthritis, inflammatory bowel diseases, dermatitis, systemic inflammatory response syndrome, encephalitis, meningitis, autoimmune diseases, allergies, cardiovascular diseases, herpes, hepatitis, AIDS, respiratory infections, gastrointestinal infection, sepsis, tuberculosis, malaria, measles, meningitis, influenza, poliomyelitis, Alzheimer's disease, Parkinson's disease, cerebral palsy, multiple sclerosis, amyotrophic lateral sclerosis, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and treatment of infertility; medicinal drinks for improving the health and well-being, for strengthening the immune system and body's defences and for prophylaxis and treatment of cancer, atherosclerosis, arthritis, inflammatory bowel diseases, dermatitis, systemic inflammatory response syndrome, encephalitis, meningitis, autoimmune diseases, allergies, cardiovascular diseases, herpes, hepatitis, AIDS, respiratory infections, gastrointestinal infection, sepsis, tuberculosis, malaria, measles, meningitis, influenza, poliomyelitis, Alzheimer's disease, Parkinson's disease, cerebral palsy, multiple sclerosis, amyotrophic lateral sclerosis, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and treatment of infertility; microorganisms, cells and preparations containing elements, fragments, fractions and lysates of microorganisms or cells for medical and veterinary purposes for prophylaxis and treatment of cancer, atherosclerosis, arthritis, inflammatory bowel diseases, dermatitis, systemic inflammatory response syndrome, encephalitis, meningitis, autoimmune diseases, allergies, cardiovascular diseases, herpes, hepatitis, AIDS, respiratory infections, gastrointestinal infection, sepsis, tuberculosis, malaria, measles, meningitis, influenza, poliomyelitis, Alzheimer's disease, Parkinson's disease, cerebral palsy, multiple sclerosis, amyotrophic lateral sclerosis, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and treatment of infertility; biological therapeutics, namely therapeutics containing cells, microorganisms, proteins, glycoproteins, peptides, glycopeptides or modified or conjugated versions thereof for prophylaxis and treatment of cancer, atherosclerosis, arthritis, inflammatory bowel diseases, dermatitis, systemic inflammatory response syndrome, encephalitis, meningitis, autoimmune diseases, allergies, cardiovascular diseases, herpes, hepatitis, AIDS, respiratory infections, gastrointestinal infection, sepsis, tuberculosis, malaria, measles, meningitis, influenza, poliomyelitis, Alzheimer's disease, Parkinson's disease, cerebral palsy, multiple sclerosis, amyotrophic lateral sclerosis, gastrointestinal diseases and for use in wound healing, formation of blood and tissue and treatment of infertility; milk ferments for pharmaceutical purposes, namely for prophylaxis or treatment of cancer, atherosclerosis, arthritis, inflammatory bowel diseases, dermatitis, systemic inflammatory response syndrome, encephalitis, meningitis, autoimmune diseases, allergies, cardiovascular diseases, herpes, hepatitis, AIDS, respiratory infections, gastrointestinal infection, sepsis, tuberculosis, malaria, measles, meningitis, influenza, poliomyelitis, Alzheimer's disease, Parkinson's disease, cerebral palsy, multiple sclerosis, amyotrophic lateral sclerosis, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and treatment of infertility; nutrients for medical purposes for supporting the immune system and body's defences, and for preventing the occurrence of diseases, namely cancer, atherosclerosis, arthritis, inflammatory bowel diseases, dermatitis, systemic inflammatory response syndrome, encephalitis, meningitis, autoimmune diseases, allergies, cardiovascular diseases, herpes, hepatitis, AIDS, respiratory infections, gastrointestinal infection, sepsis, tuberculosis, malaria, measles, meningitis, influenza, poliomyelitis, Alzheimer's disease, Parkinson's disease, cerebral palsy, multiple sclerosis, amyotrophic lateral sclerosis, gastrointestinal diseases and infertility; sugar and carbohydrates for medical purposes, namely dietetic sugar, sugar replacements. (1) Scientific and technological services and research and designer services relating thereto, namely in the field of protein production, glycosylation, optimization of protein, antibody and enzyme activity, bacteria and cell engineering, cultivation and harvesting; industrial analysis and research services in the field of protein production, glycosylation, protein, antibody and enzyme activity, bacteria and cell engineering, cultivation and harvesting; design and development of computer hardware and software; services of a chemical laboratory, services of a biological laboratory; technical surveys in the field of protein production, glycosylation, optimization of protein, antibody and enzyme activity, bacteria and cell engineering, cultivation and harvesting; preparation of scientific surveys in the field of protein production, glycosylation optimization of protein, antibody and enzyme activity, bacterial and cell engineering, cultivation and harvesting; research and development in the field of bacteriology, cytology, antibody technology, chemistry, immunology, cosmetics of expression systems, particularly for proteins and peptides; research and development of new products and technologies for others in the field of protein production, glycosylation, antibody and enzyme activity, bacteria and cell engineering, cultivation and harvesting; technical and scientific consultancy in the field of protein production, glycosylation, protein, antibody and enzyme activity, bacteria and cell engineering, cultivation and harvesting; research and development in the field of glycomics, expression systems, development and improvement of cells, cell lines and microorganisms, antibodyengineering, nutraceuticals, and nutritional supplements; research, quality control, consultancy and product development in the field of proteins, antibodies, microorganisms and cells; research and development in the field of microorganisms and cells; medical research laboratory services.
38.
Use of human cells of myeloid leukemia origin for expression of antibodies
The invention relates to a method for producing a protein molecule composition having a defined glycosylation pattern, comprising (a) introducing in a host cell which is an immortalized human blood cell at least one nucleic acid encoding at least a part of said protein; and (b) culturing said host cell under conditions which permit the production of said protein molecule composition; and (c) isolating said protein molecule composition.
C07K 16/00 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
01 - Chemical and biological materials for industrial, scientific and agricultural use
05 - Pharmaceutical, veterinary and sanitary products
42 - Scientific, technological and industrial services, research and design
44 - Medical, veterinary, hygienic and cosmetic services; agriculture, horticulture and forestry services
Goods & Services
Chemicals for use in [ industry and ] science; [ photographic chemicals; chemicals for use in agriculture, horticulture and forestry except fungicides, herbicides, insecticides and parasiticides; unprocessed artificial resins; unprocessed plastics; fertilizers; fire extinguishing compositions; tempering preparations; soldering fluxes; fermentation extract; chemicals for fermenting wine; tanning agents for use in the manufacture of leather; adhesives for industrial use; bacterial preparations other than for medical and veterinary use; cells for scientific and research use; biological preparation for use in cell cultures other than for medical or veterinary use; chemical preparations for analyses in laboratories, other than for medical or veterinary purposes; ] chemical preparations for scientific purposes [ ; biochemical and chemical reagents used for non-medical purposes; diagnostic preparations, other than for medical or veterinary purposes; Enzymes for the brewing, detergents and food industries; protein for industrial use; carbohydrates used as an ingredient in the manufacture of nutraceuticals; cultures of microorganisms, other than for medical and veterinary use; testing kits containing peptide substrates used in analyzing and detecting certain toxins for laboratory or research use; milk ferments for industrial purposes ] Pharmaceutical preparations [, veterinary preparations, medicines and biological preparations ] for use in prophylaxis or treatment of cancer, [ inflammatory diseases, autoimmune diseases, allergies, cardiovascular diseases, infectious diseases, neurological diseases, gastrointestinal diseases, reproduction medicine and for use in wound healing and formation of blood and tissue; sanitary preparations for medical use; dietetic foods, namely, milk, milk products, milk ferments, whey, kefir, yoghurt, cream and cheese adapted for medical use; food for babies; medical plasters; medical dressings; materials for dental fillings and for making dental impressions; disinfectants; preparations for destroying vermin; fungicides and herbicides; adjuvants for medical purposes; antiallergic medicines; enzyme preparations for medical purposes; protein supplements; diagnostic kits consisting primarily of monoclonal antibodies, buffers, and reagents for use in disease testing; ] cells for medical or clinical use [ ; cultures of microorganisms for medical or veterinary use; vaccines; nutritional supplements, namely, carbohydrates in powdered form; medicinal drinks; milk ferments for pharmaceutical purposes; nutritional food additives for medical purposes in the nature of natural food extracts derived from fish, meat, vegetables and microorganisms; micro-nutrient preparations for the prevention of cancer, inflammatory diseases, autoimmune diseases, allergies, cardiovascular diseases, infectious diseases, neurological diseases and gastrointestinal diseases; dietetic sugar for medical use ] [ Scientific and technological services, namely, scientific research, analysis and testing in the fields of chemicals, foods and pharmaceuticals; Industrial research in the fields of chemicals, foods and pharmaceuticals; design and development of computer hardware and software; biological research; chemical laboratories; ] scientific laboratory services specializing in biologics; [ technical surveying; scientific surveying; ] research and development in the fields of [ bacteriology, cellular engineering, cytology, ] antibodies, [ glycomics, chemistry, microorganisms, ] proteins, immunology, biological therapeutics [, nutraceuticals, nutritional supplements and protein and peptide expression systems; quality control for others; research and development of new products for others; technical consulting in the field of pharmaceutical studies; scientific consulting and research services relating to foods and dietary supplements ] [ Medical services; veterinary services; hygienic and beauty care for human beings and animals; agricultural advice; horticultural services; forest habitat restoration; pharmaceutical advice; medical laboratory services; physical examination services; conducting medical examinations for insurance purposes; food nutrition consultation; consulting services in the field of health ]
40.
CONTROLLED OVARIAN HYPERSTIMULATION WITH IMPROVED RECOMBINANT HUMAN FOLLICLE-STIMULATING HORMONE
The present invention pertains to methods for controlled ovarian hyperstimulation in a female subject using improved recombinant human follicle-stimulating hormone (rhFSH). The methods result in a high number of fertilizable oocytes even at low amounts of FSH administered to the female subject.
A61P 15/08 - Drugs for genital or sexual disordersContraceptives for gonadal disorders or for enhancing fertility, e.g. inducers of ovulation or of spermatogenesis
The present invention pertains to glycosylated peptides of the glycophorin protein and their use in medicine. In particular, the peptides carry a carbohydrate structure of interest and are capable of binding to and being presented by MHC proteins. Using the glycosylated glycophorin peptides, a specific immune response against the carbohydrate structure of interest can be induced.
C07K 14/435 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans
42.
ANTI-CANCER TREATMENTS WITH ANTI-EGFR ANTIBODIES HAVING A LOW FUCOSYLATION
The present invention pertains to the field of cancer therapy using anti-cancer antibodies. The medical use of anti-EGFR antibodies having improved glycosylation characteristics, in particular a reduced fucosylation, is provided which show anti-cancer efficacy and an improved adverse side effect profile.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
A61K 39/00 - Medicinal preparations containing antigens or antibodies
The present invention pertains to the field of recombinant protein production. Novel peptides derived from the extracellular region of a glycophorin protein are provided which enhance the expression rate of proteins or peptides of interest when expressed as fusion protein together with said novel peptides.
C07K 14/435 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans
44.
NOVEL THERAPEUTIC TREATMENTS WITH ANTI-HER2 ANTIBODIES HAVING A LOW FUCOSYLATION
The present invention pertains to the field of cancer therapy using anti-cancer antibodies. The medical use of anti-HER2 antibodies having improved glycosylation characteristics, in particular a reduced fucosylation, is provided which show enhanced efficacy.
C07K 16/32 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products from oncogenes
The present invention pertains to a method for controlling the circulation half-life of antibodies by adjusting the amount of sialic acid in the carbohydrates attached to the Fab part of the antibodies. Furthermore, the present invention provides antibodies having an increased circulation half-life.
A61K 39/395 - AntibodiesImmunoglobulinsImmune serum, e.g. antilymphocytic serum
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/00 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
C07K 16/18 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans
A61K 39/00 - Medicinal preparations containing antigens or antibodies
The present invention pertains to microorganisms of the species Bacteroides xylanisolvens expressing a core-1 antigen on their surface. These microorganisms are in particular useful for the prophylaxis and treatment of core-1 positive diseases and are particularly characterized by a stable, homogenous high core-1 expression. Also provided are pharmaceutical compositions which comprise respective core-1 positive microorganisms or fractions thereof.
The present invention pertains to food products comprising microorganisms of the species Bacteroides xylanisolvens, in particular fermented food and probiotic food. These microorganisms are particularly characterized as having a very low pathogenicity and a high safety for human consumption.Furthermore, methods for producing said food products, in particular by fermentation, as well as suitable bacterial strains Bacteroides xylanisolvens of are provided.
The present invention pertains to a method for culturing a suspension of immortalized human blood cells, preferably cells of myeloid leukaemia origin or cells derived therefrom, wherein said method provides a high productivity, a high cell viability and growth rate and a high batch-to-batch consistency, and can be scaled up without altering these parameters.
The present invention pertains to anti-mucin antibodies having improved antigen binding and/or recognition properties as well as a method for improving the antigen binding and/or recognition of an anti-mucin antibody. In particular, the present invention is directed to anti-MUC1 antibodies which are useful in the treatment of cancer.
A61K 39/395 - AntibodiesImmunoglobulinsImmune serum, e.g. antilymphocytic serum
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
50.
ANTIBODIES, FUNCTIONAL FRAGMENTS AND DERIVATIVES HAVING A SIALYLATED FAB REGION
The present invention pertains to a method for controlling the circulation half-life of antibodies by adjusting the amount of sialic acid in the carbohydrates attached to the Fab part of the antibodies. Furthermore, the present invention provides antibodies having an increased circulation half-life.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
The present invention pertains to a method for controlling the circulation half-life of antibodies by adjusting the amount of sialic acid in the carbohydrates attached to the Fab part of the antibodies. Furthermore, the present invention provides antibodies having an increased circulation half-life.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
The present invention pertains to humanized anti-EGFR antibodies having antigen binding properties similar to those of the murine or chimeric anti-EGFR antibody from which they are derived. In particular, the present invention is directed to humanized anti-EGFR antibodies which are useful in the treatment of cancer.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
The present invention pertains to improved FSH preparations which are capable of stimulating sex steroid release at much lower concentration than the commonly used urinary FSH or recombinant FSH obtained from CHO cells and which act independent of cAMP signaling. These improved FSH preparations can be used in infertility treatment.
C07K 14/435 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans
The present invention pertains to improved FSH preparations which are capable of stimulating sex steroid release at much lower concentration than the commonly used urinary FSH or recombinant FSH obtained from CHO cells and which act independent of cAMP signaling. These improved FSH preparations can be used in infertility treatment.
C07K 14/435 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans
The present invention relates to a process for the purification of a glycoprotein comprising subjecting a liquid containing said glycoprotein to the steps of: a) reverse phase chromatography, b) boronate affinity chromatography, and c) size exclusion chromatography. Also provided is a manufacturing process for producing a glycoprotein of interest.
The present invention inter alia pertains to therapeutic methods which are based on the use of an agent specifically binding a tumor-associated carbohydrate antigen for the treatment of cancer stem cells and related diseases. Also provided are diagnostic and prognostic methods using a tumor- associated carbohydrate antigen as marker for cancer stem cells.
A61K 47/48 - Medicinal preparations characterised by the non-active ingredients used, e.g. carriers, inert additives the non-active ingredient being chemically bound to the active ingredient, e.g. polymer drug conjugates
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/34 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against blood group antigens
A61K 39/395 - AntibodiesImmunoglobulinsImmune serum, e.g. antilymphocytic serum
G01N 33/50 - Chemical analysis of biological material, e.g. blood, urineTesting involving biospecific ligand binding methodsImmunological testing
The present invention relates to a process for the purification of a glycoprotein comprising subjecting a liquid containing said glycoprotein to the steps of: a) reverse phase chromatography, b) size exclusion chromatography, and c) hydrophobic interaction chromatography. Also provided is a manufacturing process for producing a glycoprotein of interest.
The present invention pertains to anti-mucin antibodies having improved antigen binding and/or recognition properties as well as a method for improving the antigen binding and/or recognition of an anti-mucin antibody. In particular, the present invention is directed to anti-MUC1 antibodies which are useful in the treatment of cancer.
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
The present invention pertains to anti-mucin antibodies having improved antigen binding and/or recognition properties as well as a method for improving the antigen binding and/or recognition of an anti-mucin antibody. In particular, the present invention is directed to anti-MUC1 antibodies which are useful in the treatment of cancer.
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
The present invention pertains to a system for culturing cells comprising a culturing bag and a continuous flow centrifuge wherein the cells are continuously separated from the supernatant and are recycled into the culturing bag. Further provided are methods for culturing cells and for producing a biological substance using the device for culturing cells, and the use of a bag for culturing cells in said device or said methods. In particular, a perfusion system for culturing cells is provided wherein the wave technology for culturing cells is combined with continuous flow centrifugation for separating the medium from the cells.
The invention relates to a method for producing a protein molecule composition having a defined glycosylation pattern, comprising (a) introducing in a host cell which is an immortalized human blood cell at least one nucleic acid encoding at least a part of said protein; and (b) culturing said host cell under conditions which permit the production of said protein molecule composition; and (c) isolating said protein molecule composition.
C12N 5/078 - Cells from blood or from the immune system
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
The present invention relates to a method of producing a fermented food, wherein a raw food material is combined with a starter culture for fermentation, which is characterized in that at least one microorganism of the genus Bacteroides and/or a at least microorganism is added having at least a cell surface structure which corresponds to a human carbohydrate structure. Further disclosed are processing aids and fermented foods containing respective microorganisms.
01 - Chemical and biological materials for industrial, scientific and agricultural use
05 - Pharmaceutical, veterinary and sanitary products
42 - Scientific, technological and industrial services, research and design
Goods & Services
Chemicals used in industry, science and photography, as well
as in agriculture, horticulture and forestry; unprocessed
artificial resins; unprocessed plastics; fertilising
preparations; fire extinguishing compositions; tempering and
soldering preparations; chemical substances for fermenting
and preserving food stuffs; tanning substances; adhesives
used in industry; bacteria and cell preparations and
elements, fragments, fractions and lysates thereof, except
for medical or veterinary purposes; preparations containing
bacteria and cells, except for medical or veterinary
purposes; biological preparations for laboratories, except
for medical or veterinary purposes; chemical preparations
for analysis in laboratories; chemical preparations for
scientific purposes; chemical and biological reagents,
except for medical or veterinary purposes; diagnostic
preparations, except for medical or veterinary purposes;
enzymes, proteins and respective preparations for industrial
purposes; ferments for chemical purposes; in-vitro
diagnostics, other than for medical purposes; carbohydrates;
cultures of microorganisms and cells and elements,
fragments, fractions and lysates thereof, other than for
medical or veterinary purposes; expression systems for
proteins and peptides, particularly on the basis of cells,
particularly human cells and microorganisms; milk ferments
for medical purposes. Pharmaceutical and veterinary preparations; sanitary
preparations for medical purposes; dietetic substances for
medical use; food for babies; plasters; materials for
dressings; materials for dental filling and impression
materials for dental purposes; disinfectants; preparations
for destroying vermin; fungicides, herbicides; particularly
adjuvants for medical purposes; medicines for human and
veterinary purposes; biological preparations for medical
purposes; dietetic food adapted for medical purposes;
enzyme, proteins, antibodies, cells, microorganisms as well
as fragments, fractions, elements and lysates thereof for
medical purposes and as nutritional additives; vaccines;
carbohydrates for medical purposes; cultures of
microorganisms for medical or veterinary purposes; cultures
of cells, particularly human cells for medical or veterinary
purposes; medical drinks; microorganisms, cells and
preparations containing elements, fragments, fractions and
lysates of microorganisms or cells for medical and
veterinary purposes; biological therapeutics; milk ferments
for pharmaceutical purposes; nutritional additives and
nutritional supplement additives; nutrients for medical
purposes; sugar and carbohydrates for medical purposes. Scientific and technological services and research and
designer services relating thereto; industrial analysis and
research services; design and development of computer
hardware and software; biological research; services of a
chemical orbiological laboratory; technical surveys;
preparation of scientific surveys; research and development
in the field of bacteriology, cytology, antibody technology,
chemistry, immunology, cosmetics of expression systems,
particularly for proteins and peptides; quality control;
research and development of new products and technologies
for others; technical and scientific consultancy; research
and development in the field of Glycomics, expression
systems, development and improvement of cells, cell lines
and microorganisms, antibody-engineering, optimised
biological therapeutics, nutraceuticals, food and
nutritional supplements; research, quality control,
consultancy and product development in the field of
proteins, antibodies, microorganisms and cells; research and
development in the field of microorganisms and cells.
01 - Chemical and biological materials for industrial, scientific and agricultural use
05 - Pharmaceutical, veterinary and sanitary products
42 - Scientific, technological and industrial services, research and design
44 - Medical, veterinary, hygienic and cosmetic services; agriculture, horticulture and forestry services
Goods & Services
Chemicals used in industry, science and photography, as well
as in agriculture, horticulture and forestry; unprocessed
artificial resins; unprocessed plastics; fertilising
preparations; fire extinguishing compositions; tempering and
soldering preparations; chemical substances for fermenting
and preserving foodstuffs; tanning substances; adhesives
used in industry; bacteria and cell preparations and
elements, fragments, fractions and lysates thereof, except
for medical or veterinary purposes; preparations containing
bacteria and cells, except for medical or veterinary
purposes; biological preparations for laboratories, except
for medical or veterinary purposes; chemical preparations
for analysis in laboratories; chemical preparations for
scientific purposes; chemical and biological reagents,
except for medical or veterinary purposes; diagnostic
preparations, except for medical or veterinary purposes;
enzymes, proteins and related preparations for industrial
purposes; ferments for chemical purposes; carbohydrates;
cultures of microorganisms and cells and elements,
fragments, fractions and lysates thereof, other than for
medical or veterinary purposes; expression systems for
proteins and peptides, particularly on the basis of cells,
particularly human cells and microorganisms; milk ferments
for chemical purposes; in-vitro diagnostics, other than for
medical purposes. Pharmaceutical and veterinary preparations; sanitary
preparations for medical purposes; dietetic substances for
medical use; food for babies; plasters; materials for
dressings; materials for dental filling and impression
materials for dental purposes; disinfectants; preparations
for destroying vermin; fungicides, herbicides; particularly
adjuvants for medical purposes; medicines for human and
veterinary purposes; biological preparations for medical
purposes; dietetic food adapted for medical purposes;
enzymes, proteins, antibodies, cells, microorganisms as well
as fragments, fractions, elements and lysates thereof for
medical purposes and as nutritional additives; vaccines;
carbohydrates for medical purposes; cultures of
microorganisms for medical or veterinary purposes; cultures
of cells, particularly human cells for medical or veterinary
purposes; medical drinks; microorganisms, cells and
preparations containing elements, fragments, fractions and
lysates of microorganisms or cells for medical and
veterinary purposes; biological therapeutics; milk ferments
for pharmaceutical purposes; nutritional additives and
nutritional supplement additives; nutrients for medical
purposes; sugar and carbohydrates for medical purposes. Scientific and technological services and research and
designer services relating thereto; industrial analysis and
research services; design and development of computer
hardware and software; biological research; services of a
chemical or biological laboratory; technical surveys;
preparation of scientific surveys; research and development
in the fields of bacteriology, cytology, antibody
technology, chemistry, immunology, cosmetics of expression
systems, particularly for proteins and peptides; quality
control; research and development of new products and
technologies for others; technical and scientific
consultancy; research and development in the fields of
glycomics, expression systems, development and improvement
of cells, cell lines and microorganisms,
antibody-engineering, optimised biological therapeutics,
nutraceuticals, food and nutritional supplements; research,
quality control, consultancy and product development in the
fields of proteins, antibodies, microorganisms and cells;
research and development in the fields of microorganisms and
cells. Medical and veterinary services; hygienic and beauty care
for human beings and animals; agriculture, horticulture and
forestry services; pharmacy advice; services of a medical
laboratory; performance of medical and clinical
examinations; nutrition consultancy; health consultancy.
01 - Chemical and biological materials for industrial, scientific and agricultural use
05 - Pharmaceutical, veterinary and sanitary products
42 - Scientific, technological and industrial services, research and design
Goods & Services
Chemicals used in industry, science and photography, as well
as in agriculture, horticulture and forestry; unprocessed
artificial resins; unprocessed plastics; fertilising
preparations; fire extinguishing compositions; tempering and
soldering preparations; chemical substances for fermenting
and preserving food stuffs; tanning substances; adhesives
used in industry; bacteria and cell preparations and
elements, fragments, fractions and lysates thereof, except
for medical or veterinary purposes; preparations containing
bacteria and cells, except for medical or veterinary
purposes; biological preparations for laboratories, except
for medical or veterinary purposes; chemical preparations
for analysis in laboratories; chemical preparations for
scientific purposes; chemical and biological reagents,
except for medical or veterinary purposes; diagnostic
preparations, except for medical or veterinary purposes;
enzymes, proteins and respective preparations for industrial
purposes; ferments for chemical purposes; in-vitro
diagnostics, other than for medical purposes; carbohydrates;
cultures of microorganisms and cells and elements,
fragments, fractions and lysates thereof, other than for
medical or veterinary purposes; expression systems for
proteins and peptides, particularly on the basis of cells,
particularly human cells and microorganisms; milk ferments
for medical purposes. Pharmaceutical and veterinary preparations; sanitary
preparations for medical purposes; dietetic substances for
medical use; food for babies; plasters; materials for
dressings; materials for dental filling and impression
materials for dental purposes; disinfectants; preparations
for destroying vermin; fungicides, herbicides; particularly
adjuvants for medical purposes; medicines for human and
veterinary purposes; biological preparations for medical
purposes; dietetic food adapted for medical purposes;
enzyme, proteins, antibodies, cells, microorganisms as well
as fragments, fractions, elements and lysates thereof for
medical purposes and as nutritional additives; vaccines;
carbohydrates for medical purposes; cultures of
microorganisms for medical or veterinary purposes; cultures
of cells, particularly human cells for medical or veterinary
purposes; medical drinks; microorganisms, cells and
preparations containing elements, fragments, fractions and
lysates of microorganisms or cells for medical and
veterinary purposes; biological therapeutics; milk ferments
for pharmaceutical purposes; nutritional additives and
nutritional supplement additives; nutrients for medical
purposes; sugar and carbohydrates for medical purposes. Scientific and technological services and research and
designer services relating thereto; industrial analysis and
research services; design and development of computer
hardware and software; biological research; services of a
chemical orbiological laboratory; technical surveys;
preparation of scientific surveys; research and development
in the field of bacteriology, cytology, antibody technology,
chemistry, immunology, cosmetics of expression systems,
particularly for proteins and peptides; quality control;
research and development of new products and technologies
for others; technical and scientific consultancy; research
and development in the field of Glycomics, expression
systems, development and improvement of cells, cell lines
and microorganisms, antibody-engineering, optimised
biological therapeutics, nutraceuticals, food and
nutritional supplements; research, quality control,
consultancy and product development in the field of
proteins, antibodies, microorganisms and cells; research and
development in the field of microorganisms and cells.
01 - Chemical and biological materials for industrial, scientific and agricultural use
05 - Pharmaceutical, veterinary and sanitary products
42 - Scientific, technological and industrial services, research and design
Goods & Services
(1) Bacteria and cell preparations and elements, fragments, fractions and lysates thereof, except for medical or veterinary purposes; preparations containing bacteria and cells, except for medical or veterinary purposes, namely, for use in protein production, food manufacturing, scientific research, waste water treatment; biological preparations for laboratories, except for medical or veterinary purposes, namely for use in bacterial and cell engineering, cultivation, harvesting, protein production; chemical preparations for analysis in laboratories, namely, preparations for analysis of proteins, peptides, engineered proteins and peptides, glycoproteins, glycosylation, antibodies or antigens, preparations comprising antibody reagents used for the detection of antigens; chemical preparations for scientific purposes, namely, preparations for preparation, engineering, storage or analysis of proteins, peptides, engineered proteins and peptides, glycoproteins, glycosylation, antibodies, antigens, nucleic acids, saccharides, cells and microorganisms; chemical and biological reagents in the nature of reagents for use in protein production, bacterial and cell engineering, cultivation and harvesting, probes for detecting and analyzing molecules in protein or nucleotide arrays, except for medical or veterinary purposes; in-vitro diagnostic preparations, except for medical or veterinary purposes; enzymes, proteins and respective preparations for industrial purposes, namely engineered proteins, glycosylated proteins, antibodies, enzymes for use in glycosylation, enzyme substrates, proteins used in the manufacture of cosmetics, beverages, food products and food supplements; in-vitro diagnostic reagents, other than for medical purposes, namely for use in biochemistry, clinical chemistry and microbiology;cultures of microorganisms and cells and elements, fragments, fractions and lysates thereof, other than for medical or veterinary purposes; expression systems for proteins and peptides, particularly on the basis of cells, particularly human cells and microorganisms, namely, expression systems for engineered or glycosylated proteins or peptides, expression systems with optimized glycosylation activity. (1) Scientific and technological services and research and designer services relating thereto, namely in the field of biotechnology, protein production, glycosylation, optimization of protein, antibody and enzyme activity, bacteria and cell engineering, cultivation and harvesting; industrial analysis and research services in the field of biotechnology, protein production, glycosylation, protein, antibody and enzyme activity, bacteria and cell engineering, cultivation and harvesting; biological research; services of a chemical or biological laboratory; technical surveys in the field of biotechnology, protein production, glycosylation, optimization of protein, antibody and enzyme activity, bacteria and cell engineering, cultivation and harvesting; preparation of scientific surveys in the field of biotechnology, protein production, glycosylation optimization of protein, antibody and enzyme activity, bacterial and cell engineering, cultivation and harvesting; research and development in the field of bacteriology, cytology, antibody technology, chemistry, immunology, cosmetics of expression systems, particularly for proteins and peptides; quality control; research and development of new products and technologies for others in the field of biotechnology, protein production, glycosylation, protein, antibody and enzyme activity, bacteria and cell engineering, cultivation and harvesting; technical and scientific consultancy in relation to biotechnology, protein production, glycosylation, protein, antibody and enzyme activity, bacteria and cell engineering, cultivation and harvesting; research and development in the field of glycomics, expression systems, development and improvement of cells, cell lines and microorganisms, antibody-engineering, optimised biological therapeutics, nutraceuticals, food and nutritional supplements; research, quality control, consultancy and product development in the field of proteins, antibodies, microorganisms and cells; research and development in the field of microorganisms and cells.
01 - Chemical and biological materials for industrial, scientific and agricultural use
05 - Pharmaceutical, veterinary and sanitary products
42 - Scientific, technological and industrial services, research and design
Goods & Services
[ Chemicals used in industry, science and photography, as well as in agriculture, horticulture and forestry, except fungicides, herbicides, insecticides and parasiticides; unprocessed artificial resins; unprocessed plastics; fertilising preparations; fire extinguishing compositions; tempering and soldering chemicals; chemical substances for fermenting and preserving food stuffs; tanning agents for use in the manufacture of leather; adhesives used in industry; bacteria and cell preparations and elements, fragments, fractions and lysates thereof, except for medical or veterinary purposes, namely, for use in protein production, food manufacturing, scientific research, waste water treatment, bacteria and cell preparations for use in expression of engineered or glycosylated proteins and peptides; preparations containing bacteria and cells, except for medical or veterinary purposes, namely, for use in protein production, food manufacturing, scientific research, waste water treatment; biological preparations for laboratories, except for medical or veterinary purposes, namely, for use in bacterial and cell engineering, cultivation, harvesting, protein production; chemical preparations for analysis in laboratories, namely, preparations for protein, peptide, engineered proteins and peptides, glycoproteins, glycosylation, antibody or antigen analysis, preparations comprising antibody reagents used for the detection of antigens; chemical preparations for scientific purposes; chemical reagents except for medical or veterinary purposes and biological reagents in the nature of reagents for use in protein production, bacterial and cell engineering, cultivation and harvesting, probes for detecting and analyzing molecules in protein or nucleotide arrays, except for medical or veterinary purposes; diagnostic preparations, except for medical or veterinary purposes; enzymes, proteins and respective preparations for industrial purposes, namely, engineered proteins, glycosylated proteins, antibodies, enzymes for use in glycosylation, enzyme substrates, proteins used in the manufacture of cosmetics, beverages, food products and food supplements; ferments for chemical purposes, namely, yeast, bacterium, mold, or enzyme, that causes fermentation; in-vitro diagnostics, other than for medical purposes; carbohydrates for use in the manufacture of food and nutraceuticals; cultures of microorganisms and cells and elements, fragments, fractions and lysates thereof, other than for medical or veterinary purposes, namely, cultures of microorganisms and cells other than for medical and veterinary use, microorganism or cell cultures for use in protein production, food manufacturing, scientific research, waste water treatment, cultures of microorganisms or cells for use in expression of glycosylated proteins and peptides; expression systems for proteins and peptides comprising cells, particularly human cells and microorganisms suitable for expressing engineered or glycosylated proteins or peptides, or capable of providing optimized glycosylation; milk ferments for medical research purposes ] [ Pharmaceutical and veterinary preparations for prophylaxis or treatment of cancer, inflammatory diseases, autoimmune diseases, allergies, cardiovascular diseases, infectious diseases, neurological diseases, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and reproduction medicine; sanitary preparations for medical purposes; dietetic foods adapted for medical use; food for babies; medical plasters; materials for medical dressings; materials for dental filling and impression materials for dental purposes; disinfectants for sanitary purposes; preparations for destroying vermin; fungicides, herbicides; adjuvants for medical purposes; Medicines for human and veterinary purposes for prophylaxis or treatment of cancer, inflammatory diseases, autoimmune diseases, [ allergies, cardiovascular diseases, ] infectious diseases, [ neurological diseases, ] gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and reproduction medicine; biological preparations for medical purposes; dietetic food adapted for medical purposes; enzyme, proteins, antibodies, cells, microorganisms as well as fragments, fractions, elements and lysates thereof for medical purposes for prophylaxis or treatment of cancer, inflammatory diseases, autoimmune diseases, allergies, cardiovascular diseases, infectious diseases, neurological diseases, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and reproduction medicine, and as nutritional additives for medical purposes for use in foods and dietary supplements for human consumption; vaccines; carbohydrates for medical purposes for prophylaxis or treatment of cancer, inflammatory diseases, autoimmune diseases, allergies, cardiovascular diseases, infectious diseases, neurological diseases, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and reproduction medicine; cultures of microorganisms for medical or veterinary purposes for prophylaxis or treatment of cancer, inflammatory diseases, autoimmune diseases, allergies, cardiovascular diseases, infectious diseases, neurological diseases, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and reproduction medicine; cultures of human cells for medical or veterinary purposes for prophylaxis or treatment of cancer, inflammatory diseases, autoimmune diseases, allergies, cardiovascular diseases, infectious diseases, neurological diseases, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and reproduction medicine; medical drinks for prophylaxis or treatment of cancer, inflammatory diseases, autoimmune diseases, allergies, cardiovascular diseases, infectious diseases, neurological diseases, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and reproduction medicine; microorganisms, cells and preparations containing elements, fragments, fractions and lysates of microorganisms or cells for medical and veterinary purposes for prophylaxis or treatment of cancer, inflammatory diseases, autoimmune diseases, allergies, cardiovascular diseases, infectious diseases, neurological diseases, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and reproduction medicine; biological therapeutics, namely, therapeutics containing cells, microorganisms, proteins, glycoproteins, peptides, glycopeptides or modified or conjugated versions thereof ; milk ferments for pharmaceutical purposes for prophylaxis or treatment of cancer, inflammatory diseases, autoimmune diseases, allergies, cardiovascular diseases, infectious diseases, neurological diseases, gastrointestinal diseases, and for use in wound healing, formation of blood and tissue and reproduction medicine; nutritional additives and nutritional supplement additives for medical purposes for use in foods and dietary supplements for human consumption; nutrients for medical purposes, namely, enzymes, proteins, antibodies, cells, microorganisms as well as fragments, fractions, elements and lysates thereof as nutritional additives; sugar and carbohydrates for medical purposes, namely, therapeutically and prophylactically active sugar and carbohydrates, dietetic sugar and carbohydrates, sugar and carbohydrate replacements ] Scientific and technological services and research and designer services relating thereto, namely, scientific research, scientific analysis, technology consultation and research, product development and optimization in the field of biotechnology, protein production, glycosylation, optimization of protein, antibody and enzyme activity, [ bacteria ] and cell engineering, cultivation and harvesting; industrial analysis and research services in the field of biotechnology, protein production, glycosylation, protein, antibody and enzyme activity, [ bacteria ] and cell engineering, cultivation and harvesting; [ design and development of computer hardware and software; ] biological research; services of a [ chemical or ] biological laboratory; [ technical surveys, namely, ] conducting biotechnology surveys, [ pharmacology surveys; ] conducting scientific surveys in the field of biotechnology, [ bacterial and ] cell engineering, protein production, glycosylation; research and development in the field of [ bacteriology, ] cytology, antibody technology, [ chemistry, ] immunology, [ cosmetics of expression systems in the nature of glycosylation of proteins, peptides, antibodies and enzymes, particularly for proteins and peptides; quality control; ] research and development of new products and technologies in the field of biotechnology, protein production, glycosylation, protein, antibody and enzyme activity, [ bacteria and ] cell engineering, cultivation and harvesting for others; technology and scientific consultancy in the field of biotechnology, protein production, glycosylation, protein, antibody and enzyme activity, [ bacteria and ] cell engineering, cultivation and harvesting; research and development in the field of glycomics, expression systems in the nature of glycosylation of proteins, peptides, antibodies and enzymes, development and improvement of cells, cell lines [ and microorganisms, ] antibody-engineering, optimised biological therapeutics, [ nutraceuticals, and food and nutritional supplements; ] research, quality control, technology consultancy and product development in the field of proteins, antibodies, [ microorganisms ] and cells; research and development in the field of [ microorganisms and ] cells
Antibody comprising at least a variable heavy chain and variable light chain, whereby the variable heavy chain is: QVQLKQSG PGLVQPSQSLS ITCTVSGFSLTNYGVHWVRQS PGKGLEWLGVIWS GGNTDYN TPFTSRLSiNKDNSKSQVFFKMNSLQSH 溜;TAI Y YCARALT YYDYEFAYWGQGTLVTVSTA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMI SRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS 7YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQ QGNVFSCSVMHEGLHNHYTQKSLSLSPGK and/or the variable light chain is: DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTKGSPRLLIKYASESISGIPS RFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFI FPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC.
C07K 16/32 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products from oncogenes
A61K 39/395 - AntibodiesImmunoglobulinsImmune serum, e.g. antilymphocytic serum
The present invention relates to highly active glycoproteins with specific sialylation degrees, a pharmaceutical composition for use in diagnosis or therapy comprising the glycoproteins, a method for the determination of highly active glycoproteins and of the conditions for their production, a method for producing the highly active glycoproteins, and a method for differential sialylation of secretory glycoproteins. The invention also relates to the use of the recombinantly expressed highly active glycoproteins for biological purposes and for prophylactic and/or therapeutic treatment or diagnosis of diseases, particularly bone marrow transplantation, neutropenia, cytopenia, AML and myelodysplastic syndromes, cancer, HIV and/or diseases of hematopoietic systems.
The present invention relates to the field of prevention and treatment of disorders associated with the occurrence of certain carbohydrate epitopes. More particularly, the present invention relates to the prevention and treatment of carbohydrate epitope positive tumors. It relates to formulations and methods for the induction of an effective carbohydrate specific cellular immune response.
The present invention relates to the field of prevention and treatment of tumors and gastrointestinal disorders. More particularly, the present invention relates to the prevention and treatment of Core-1 -positive carcinomas. It relates to coreotics and a method of producing the same and to a method of prevention and treatment of core-1 positive disorders using the same.
The application relates to a method for producing a protein molecule composition having a defined glycosylation pattern, comprising: a) introducing in a host cell which is an immortalized human blood cell at least one nucleic acid encoding at least a part of said protein; and b) culturing said host cell under conditions which permit the production of said protein molecule composition; and c) isolating said protein molecule composition.
C07K 16/00 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C12N 5/10 - Cells modified by introduction of foreign genetic material, e.g. virus-transformed cells
C12N 15/00 - Mutation or genetic engineeringDNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purificationUse of hosts therefor
The application relates to a method for producing a protein molecule composition having a defined glycosylation pattern, comprising: a) introducing in a host cell which is an immortalized human blood cell at least one nucleic acid encoding at least a part of said protein; and b) culturing said host cell under conditions which permit the production of said protein molecule composition; and c) isolating said protein molecule composition.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
C07K 16/30 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
C12N 5/10 - Cells modified by introduction of foreign genetic material, e.g. virus-transformed cells
74.
Recognition molecules for the treatment and detection of tumors
The invention relates to recognition molecules directed towards tumors, and it also relates to pharmaceutical compositions comprising such recognition molecules, methods for the production of such recognition molecules, and to the use of such recognition molecules in the diagnosis and therapy of tumor diseases.
The present invention relates to highly active glycoproteins with specific sialylation degrees, a pharmaceutical composition for use in diagnosis or therapy comprising the glycoproteins, a method for the determination of highly active glycoproteins and of the conditions for their production, a method for producing the highly active glycoproteins, and a method for differential sialylation of secretory glycoproteins. The invention also relates to the use of the recombinantly expressed highly active glycoproteins for biological purposes and for prophylactic and/or therapeutic treatment or diagnosis of diseases, particularly bone marrow transplantation, neutropenia, cytopenia, AML and myelodysplastic syndromes, cancer, HIV and/or diseases of hematopoietic systems.
C12P 19/26 - Preparation of nitrogen-containing carbohydrates
A61K 38/17 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans
