Abstract

The present invention provides a pharmaceutical composition for preventing or treating interstitial cystitis/bladder pain syndrome, the pharmaceutical composition containing an inhibitor against at least one type of integrin selected from the group consisting of integrin αvβ3, integrin αvβ5, and integrin α5β1. The present invention also provides a method for evaluating the effect of a substance being tested on interstitial cystitis/bladder pain syndrome, the method including using, as an index, inhibiting activity against at least one type of integrin selected from the group consisting of αvβ3, αvβ5, and α5β1.

IPC Classes  ?

• A61K 38/12 - Cyclic peptides
• A61K 31/10 - Sulfides; Sulfoxides; Sulfones
• A61K 31/56 - Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids
• A61K 31/727 - Heparin; Heparan
• A61K 38/07 - Tetrapeptides
• A61P 13/10 - Drugs for disorders of the urinary system of the bladder

Abstract

To provide an endoscope diagnosis program, an endoscope diagnosis device, a control method for an endoscope diagnosis device, and a program for generating an endoscope diagnosis trained model which each make it possible to use endoscope images that have been accumulated to date to diagnose the presence or absence of a lesion, without limitations on the type of endoscope device. [Solution] A computer is made to function as: a diagnostic-use image acquisition unit 66 that acquires a diagnostic-use image of a site that is subject to diagnosis which has been captured with an endoscope device 20; a color tone correction unit 67 that performs color tone correction on the diagnostic-use image in accordance with a reference color tone, which is a color tone of an image of a site subject to diagnosis having been captured in advance with the endoscope device; and a lesion presence/absence diagnosis unit 68 that inputs the corrected diagnostic-use image into a trained model and that performs a process for diagnosing the presence or absence of a lesion from a result output by the trained model, said trained model having being generated by machine learning of a plurality of training images which have been subjected to color tone correction with the reference color tone.

IPC Classes  ?

• A61B 1/045 - Control thereof
• G06T 7/00 - Image analysis

Abstract

The present invention relates to a novel zinc polyphosphate, a use thereof, and a method for producing the same. More specifically, the present invention relates to: a zinc polyphosphate which is characterized by showing a halo peak at 2θ=4° to 7° in X-ray diffraction; a pharmaceutical composition which contains said zinc polyphosphate as an active ingredient; and a method for producing zinc polyphosphate, the method comprising (1) a step of adding zinc ions to a polyphosphate solution under alkaline conditions, preferably at a pH of 8 to 11, and (2) a step of recovering, as zinc polyphosphate, a solid obtained in step (1).

IPC Classes  ?

• C01B 25/40 - Polyphosphates
• A61K 33/42 - Phosphorus; Compounds thereof
• A61P 1/04 - Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
• A61P 29/00 - Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]

Abstract

The present invention relates to a pharmaceutical composition for the treatment or prevention of inflammatory bowel diseases, said pharmaceutical composition containing zinc polyphosphate as an active ingredient. The zinc polyphosphate in the present invention has intestinal-canal-barrier enhancing activity and can treat or prevent inflammatory bowel diseases such as ulcerative colitis and Crohn's disease.

IPC Classes  ?

• A61K 33/30 - Zinc; Compounds thereof
• A61K 33/42 - Phosphorus; Compounds thereof
• A61P 1/04 - Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
• A61P 29/00 - Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]

Abstract

The present invention provides a drive control method for a magnetically levitated bloodflow pump, a drive control device for a magnetically levitated bloodflow pump, and a magnetically levitated bloodflow pump system with which it is possible to reliably sense the position of a thrombus from the phase difference Δφ between the phase of an electromagnet current waveform and the phase of impeller displacement (phase of a vibration waveform) without depending on blood temperature or viscosity μ, and prevent thrombus formation in a housing. This drive control device 30 comprises: a rotation drive control unit 31 functioning as a rotation drive control means for causing, in a magnetically levitated bloodflow pump 20 provided with an electric motor 24 for turning an impeller 23 in a housing 22 by means of a magnetic coupling force in a z-axis direction in a state in which the impeller 23 is magnetically levitated by magnetic levitation electromagnets 25X, 25Y, the impeller 23 to rotate; and a revolution drive control unit 32 functioning as a revolution drive control means for moving the center of rotation of the impeller 23 so as to draw an orbital trajectory moved in the radial direction, and causing the impeller 23 to revolve. The drive control device 30 causes the impeller 23 to rotate as well as revolve in the housing 22.

IPC Classes  ?

• A61M 60/822 - Magnetic bearings specially adapted for being actively controlled
• A61M 60/113 - Extracorporeal pumps, i.e. the blood being pumped outside the patient’s body incorporated within extracorporeal blood circuits or systems in other functional devices, e.g. dialysers or heart-lung machines
• A61M 60/117 - Extracorporeal pumps, i.e. the blood being pumped outside the patient’s body for assisting the heart, e.g. transcutaneous or external ventricular assist devices
• A61M 60/232 - Centrifugal pumps
• A61M 60/38 - Blood oxygenation
• A61M 60/419 - Blood pumps; Devices for mechanical circulatory actuation; Balloon pumps for circulatory assistance - Details relating to driving for non-positive displacement blood pumps the force acting on the blood contacting member being permanent magnetic, e.g. from a rotating magnetic coupling between driving and driven magnets
• A61M 60/508 - Electronic control means, e.g. for feedback regulation
• A61M 60/804 - Impellers
• F04D 29/048 - Bearings electromagnetic
• F16C 32/04 - Bearings not otherwise provided for using magnetic or electric supporting means

Abstract

A medical system of an aspect example includes a data acquiring unit and a data processor. The data acquiring unit is configured to acquire data from an eye fundus of a patient using at least one optical method. The data processor is configured to process the data acquired by the data acquiring unit in order to generate information on the circulatory system of the patient.

IPC Classes  ?

• A61B 3/12 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions for looking at the eye fundus, e.g. ophthalmoscopes
• A61B 5/026 - Measuring blood flow

Abstract

According to the present invention, through an electronic motor 24 for a centrifugal blood pump 20 being controlled by a motor controller 31, a rotation number of the electric motor 24 is periodically increased during steady-flow driving in which blood is supplied as a steady flow by way of a blood outflow–side blood supply tube 11B which is connected to a blood outflow port 21B of the centrifugal blood pump 20. Through the periodical occurrence of an unsteady flow in the steady flow of blood, blood-retaining portions occurring in a blood circulation path in a blood circulation system 30 are removed, or in other words, through the electric motor 24 rotation number fluctuation control function by the motor controller 31, thrombus formation in an ECMO is inhibited, and a high thrombus prevention effect is exhibited.

IPC Classes  ?

• A61M 60/546 - Regulation using real-time blood pump operational parameter data, e.g. motor current of blood flow, e.g. by adapting rotor speed
• A61M 60/113 - Extracorporeal pumps, i.e. the blood being pumped outside the patient’s body incorporated within extracorporeal blood circuits or systems in other functional devices, e.g. dialysers or heart-lung machines
• A61M 60/232 - Centrifugal pumps
• A61M 60/37 - Haemodialysis, haemofiltration or diafiltration
• A61M 60/38 - Blood oxygenation
• A61M 60/416 - Blood pumps; Devices for mechanical circulatory actuation; Balloon pumps for circulatory assistance - Details relating to driving for non-positive displacement blood pumps the force acting on the blood contacting member being mechanical, e.g. transmitted by a shaft or cable generated by an electromotor transmitted directly by the motor rotor drive shaft

Abstract

The present invention provides a pharmaceutical composition for preventing or treating interstitial cystitis/bladder pain syndrome, the pharmaceutical composition containing an inhibitor against at least one type of integrin selected from the group consisting of integrin αvβ3, integrin αvβ5, and integrin α5β1. The present invention also provides a method for evaluating the effect of a substance being tested on interstitial cystitis/bladder pain syndrome, the method including using, as an index, inhibiting activity against at least one type of integrin selected from the group consisting of αvβ3, αvβ5, and α5β1.

IPC Classes  ?

• A61K 45/00 - Medicinal preparations containing active ingredients not provided for in groups
• A61K 31/56 - Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids
• A61K 31/727 - Heparin; Heparan
• A61K 38/07 - Tetrapeptides
• A61K 38/08 - Peptides having 5 to 11 amino acids
• A61K 38/12 - Cyclic peptides
• A61P 13/10 - Drugs for disorders of the urinary system of the bladder
• A61P 29/00 - Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
• A61P 43/00 - Drugs for specific purposes, not provided for in groups

Abstract

The present invention relates to a platelet aggregating agent containing amorphous polyphosphate as an active ingredient, wherein the polyphosphate is a Ca salt of polyphosphate. The platelet aggregating agent acts on damaged gastrointestinal mucosa in inflammatory bowel disease and exerts a platelet aggregating action, thereby allowing remission/improvement of the inflammatory bowel disease.

IPC Classes  ?

• A61K 31/80 - Polymers containing hetero atoms not provided for in groups
• A61P 1/04 - Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
• A61P 7/04 - Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents

Abstract

An antigen peptide which contains at least five continuous amino acid residues contained in the amino acid sequence represented by SEQ ID NO: 52, has an activity of inducing a cytotoxic T cell and/or a helper T cell, and can induce the cellular immunity against SARS-CoV-2.

IPC Classes  ?

• C12N 15/50 - Coronaviridae, e.g. infectious bronchitis virus, transmissible gastroenteritis virus
• A61K 39/215 - Coronaviridae, e.g. avian infectious bronchitis virus
• A61K 48/00 - Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
• A61P 31/14 - Antivirals for RNA viruses
• A61P 37/04 - Immunostimulants
• A61P 43/00 - Drugs for specific purposes, not provided for in groups
• C07K 7/06 - Linear peptides containing only normal peptide links having 5 to 11 amino acids
• C07K 14/165 - Coronaviridae, e.g. avian infectious bronchitis virus
• C07K 14/74 - Major histocompatibility complex (MHC)
• C12N 5/0783 - T cells; NK cells; Progenitors of T or NK cells
• C12N 15/63 - Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
• C12Q 1/04 - Determining presence or kind of microorganism; Use of selective media for testing antibiotics or bacteriocides; Compositions containing a chemical indicator therefor

Abstract

[Problem] To provide a method of producing a sample for gene analysis for PCR, and a PCR method and a gene analysis method using the sample. [Solution] A method of producing a sample for gene analysis, said method comprising a collected substance suspension step for suspending a collected substance, which is cells or a tissue collected from a subject, in nuclease-free water.

IPC Classes  ?

• C12Q 1/24 - Methods of sampling, or inoculating or spreading a sample; Methods of physically isolating an intact microorganism
• C12Q 1/686 - Polymerase chain reaction [PCR]
• G01N 1/28 - Preparing specimens for investigation
• G01N 33/53 - Immunoassay; Biospecific binding assay; Materials therefor

Abstract

A medical system 1 as in an exemplary embodiment comprises a data acquisition unit 10 and a data processing unit 20. The data acquisition unit 10 uses at least one optical method to acquire data from the fundus of a patient's eye. The data processing unit 20 processes the data acquired by the data acquisition unit 10 in order to generate information pertaining to the patient's cardiovascular system.

IPC Classes  ?

• G16H 20/00 - ICT specially adapted for therapies or health-improving plans, e.g. for handling prescriptions, for steering therapy or for monitoring patient compliance
• A61B 3/10 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions
• A61B 3/12 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions for looking at the eye fundus, e.g. ophthalmoscopes
• A61B 5/026 - Measuring blood flow

Abstract

The blood flow analysis apparatus includes an acquisition unit and an extractor. The acquisition unit is configured to acquire blood flow information representing time-course changes in a blood flow velocity of a single retinal artery or retinal vein. The extractor is configured to extract one or more parameters corresponding to change in the blood flow velocity from the blood flow information.

IPC Classes  ?

• A61B 3/12 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions for looking at the eye fundus, e.g. ophthalmoscopes
• A61B 3/10 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions

Abstract

The present invention pertains to a platelet aggregator that contains amorphous polyphosphoric acid as an active ingredient, wherein the polyphosphoric acid is a Ca salt of polyphosphoric acid. The platelet aggregator acts on damaged gastrointestinal mucosa in inflammatory bowel disease and can bring about remission/improvement of the inflammatory bowel disease by exerting a platelet aggregating effect.

IPC Classes  ?

• A61K 33/42 - Phosphorus; Compounds thereof
• A61K 9/14 - Particulate form, e.g. powders
• A61P 1/04 - Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
• A61P 7/04 - Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
• A61P 17/02 - Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like

Abstract

A connector (1) includes: a tube (10) configured to be arranged in an interior of a vascular channel; a tubular body (30) having an inner wall surface configured to, together with an outer wall surface of the tube (10), sandwich the vascular channel when the tube (10) is arranged in the interior of the vascular channel; and a balloon (20), configured to be arranged on the outer wall surface of the tube (10) or the inner wall surface of the tubular body (30), and radially expand for performing sealing (i) between the soft tubular member and the inner wall surface of the tubular body (30) and (ii) between the soft tubular member and the outer wall surface of the tube (10). A fluid supply system (100) may include the connector (1), and a perfusion solution supply device (120) connected to the connector (1) and configured to supply a perfusion solution into the interior of the vascular channel.

IPC Classes  ?

• A01N 1/02 - Preservation of living parts
• A61M 25/10 - Balloon catheters

Abstract

The present invention addresses the problem of providing a novel therapeutic strategy against erectile dysfunction. Disclosed is an erectile dysfunction therapeutic agent that contains a filtrate obtained by filtering a liquid of disrupted fat-tissue-derived stem cells or disrupted bone-marrow-derived stem cells.

IPC Classes  ?

• A61K 35/28 - Bone marrow; Haematopoietic stem cells; Mesenchymal stem cells of any origin, e.g. adipose-derived stem cells
• A61K 35/35 - Fat tissue; Adipocytes; Stromal cells; Connective tissues 
• A61K 45/00 - Medicinal preparations containing active ingredients not provided for in groups
• A61P 15/10 - Drugs for genital or sexual disorders; Contraceptives for impotence

Abstract

Provided is a peptide which comprises 10-45 amino acids containing: an amino acid sequence KILQQSRIVQX (wherein X is nil or represents S); an amino acid sequence consisting of 10 or more consecutive amino acids in an amino acid sequence DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or an amino acid sequence QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9), or a peptide which is derived from one of the aforesaid peptides by the substitution, deletion or addition of 1-3 amino acids and has an ability to activate helper T cells. Also provided are a polynucleotide, etc. relating to the peptide. Also provided is a method for using the peptide, polynucleotide, etc. as a medicine or as a helper T cell activator.

IPC Classes  ?

• C12N 15/12 - Genes encoding animal proteins
• C12N 5/0783 - T cells; NK cells; Progenitors of T or NK cells
• A61K 35/15 - Cells of the myeloid line, e.g. granulocytes, basophils, eosinophils, neutrophils, leucocytes, monocytes, macrophages or mast cells; Myeloid precursor cells; Antigen-presenting cells, e.g. dendritic cells
• A61K 35/17 - Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
• A61K 35/76 - Viruses; Subviral particles; Bacteriophages
• A61K 38/10 - Peptides having 12 to 20 amino acids
• A61K 38/16 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
• A61K 48/00 - Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
• A61P 1/04 - Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
• A61P 11/00 - Drugs for disorders of the respiratory system
• A61P 35/00 - Antineoplastic agents
• C07K 7/08 - Linear peptides containing only normal peptide links having 12 to 20 amino acids
• C07K 14/47 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from humans from vertebrates from mammals
• C07K 19/00 - Hybrid peptides
• C12N 5/10 - Cells modified by introduction of foreign genetic material, e.g. virus-transformed cells
• C12N 15/63 - Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
• C07K 14/74 - Major histocompatibility complex (MHC)
• C12P 21/02 - Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione

Abstract

Provided is a peptide which comprises 10-45 amino acids containing: an amino acid sequence KILQQSRIVQX (wherein X is nil or represents S); an amino acid sequence consisting of 10 or more consecutive amino acids in an amino acid sequence DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or an amino acid sequence QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9), or a peptide which is derived from one of the aforesaid peptides by the substitution, deletion or addition of 1-3 amino acids and has an ability to activate helper T cells. Also provided are a polynucleotide, etc. relating to the peptide. Also provided is a method for using the peptide, polynucleotide, etc. as a medicine or as a helper T cell activator.

IPC Classes  ?

• C12N 15/12 - Genes encoding animal proteins
• A61K 35/15 - Cells of the myeloid line, e.g. granulocytes, basophils, eosinophils, neutrophils, leucocytes, monocytes, macrophages or mast cells; Myeloid precursor cells; Antigen-presenting cells, e.g. dendritic cells
• A61K 35/17 - Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
• A61K 35/76 - Viruses; Subviral particles; Bacteriophages
• A61K 38/08 - Peptides having 5 to 11 amino acids
• A61K 38/10 - Peptides having 12 to 20 amino acids
• A61K 38/16 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
• A61K 48/00 - Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
• A61P 1/04 - Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
• A61P 11/00 - Drugs for disorders of the respiratory system
• A61P 35/00 - Antineoplastic agents
• C07K 7/08 - Linear peptides containing only normal peptide links having 12 to 20 amino acids
• C07K 14/47 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from humans from vertebrates from mammals
• C07K 19/00 - Hybrid peptides
• C12N 5/0783 - T cells; NK cells; Progenitors of T or NK cells
• C12N 5/10 - Cells modified by introduction of foreign genetic material, e.g. virus-transformed cells
• C12N 15/63 - Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
• C07K 14/74 - Major histocompatibility complex (MHC)
• C12P 21/02 - Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione

Abstract

The purpose of the present invention is to provide an echinomycin derivative having anti-cancer activity equal to or greater than that of echinomycin, and a production method therefor based on a chemical procedure. Provided are an echinomycin derivative represented by formula (I), and a production method therefor based on a chemical procedure.

IPC Classes  ?

• C07K 11/02 - Depsipeptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof cyclic, e.g. valinomycins
• A61K 38/12 - Cyclic peptides
• A61P 35/00 - Antineoplastic agents

Abstract

[Problem] To provide a highly safe and efficacious antitumor agent that is derived from probiotics. 5-(trans-4-carboxy-3-methylpent-2-enoyl) group. According to the present invention, a highly safe and efficacious antitumor agent can be provided.

IPC Classes  ?

• A61K 38/12 - Cyclic peptides
• A61K 38/00 - Medicinal preparations containing peptides
• A61K 33/26 - Iron; Compounds thereof
• A61P 1/00 - Drugs for disorders of the alimentary tract or the digestive system
• A61P 35/00 - Antineoplastic agents

Abstract

A blood flow measurement apparatus of an embodiment includes an image acquisition unit, an image region specification unit, a measurement location setting unit, a scanner, and a blood flow information generation unit. The image acquisition unit acquires an image of a living body. The image region specification unit analyzes the image to specify a plurality of blood vessel regions. The measurement location setting unit sets a plurality of measurement locations that intersects with the plurality of blood vessel regions. The scanner scans a plurality of cross sections of the living body corresponding to the plurality of measurement locations using optical coherence tomography. The blood flow information generation unit generates blood flow information on the living body based on data acquired through the scan.

IPC Classes  ?

• A61B 3/12 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions for looking at the eye fundus, e.g. ophthalmoscopes
• G01N 21/17 - Systems in which incident light is modified in accordance with the properties of the material investigated
• A61B 3/10 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions
• A61B 5/026 - Measuring blood flow
• A61B 5/00 - Measuring for diagnostic purposes ; Identification of persons
• A61B 3/00 - Apparatus for testing the eyes; Instruments for examining the eyes

Abstract

The present invention comprises a connector (1) and a fluid supply system (100). The connector (1) is provided with: a tube (10) that can be placed within a vascular channel; a tubular body (30) having an inner wall surface that, in concert with the outer wall surface of the tube (10) placed within the vascular channel, is capable of sandwiching the vascular channel therebetween; and a balloon (20) that is disposed on the outer wall surface of the tube (10) or the inner wall surface of the tubular body (30) and is capable of expanding radially so that the inner wall surface of the tubular body (30) and the outer wall surface of the tube (10) create a seal with the vascular channel. The fluid supply system (100) may be provided with the connector (1) and a perfusion fluid supply device (120) that is connected to the connector (1) and capable of supplying a perfusion fluid into a vascular channel.

IPC Classes  ?

• A61B 17/12 - Surgical instruments, devices or methods, e.g. tourniquets for ligaturing or otherwise compressing tubular parts of the body, e.g. blood vessels or umbilical cord
• A01N 1/02 - Preservation of living parts

Abstract

[Problem] To provide an agent for preventing the onset of idiopathic osteonecrosis of the femoral head and/or suppressing the progress of the same. [Solution] An agent for preventing the onset of idiopathic osteonecrosis of the femoral head and/or suppressing the progress of the same comprising parathyroid hormone or a derivative thereof as an active ingredient, characterized by being administered intermittently.

IPC Classes  ?

• A61K 38/29 - Parathyroid hormone (parathormone); Parathyroid hormone-related peptides
• A61P 19/06 - Antigout agents, e.g. antihyperuricemic or uricosuric agents
• A61K 9/19 - Particulate form, e.g. powders lyophilised
• A61P 19/08 - Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
• A61K 9/00 - Medicinal preparations characterised by special physical form

Abstract

The present invention pertains to: a fat reducing agent which contains fibroblast growth factor 9 as an active ingredient and which reduces the amount of fat accumulated in hepatic cells; and a drug that is for the treatment and/or prevention of fatty liver diseases, particularly NAFLD, and contains said fat reducing agent as an active ingredient. The present invention is capable of ameliorating fatty liver associated with fatty liver diseases, particularly NASH/NAFLD, and/or reducing the accumulation of fat in the liver, and makes it possible to provide a direct therapeutic means and/or a preventative means for fatty liver diseases, independent of or in addition to exercise therapy. The present invention also pertains to a drug which contains FGF-9 or a functional equivalent thereof as an active ingredient and which is for reducing blood cholesterol and/or inhibiting an increase in blood cholesterol in subjects affected by or at a risk of being affected by fatty liver diseases, particularly NAFLD.

IPC Classes  ?

• A61K 38/18 - Growth factors; Growth regulators
• A61K 31/7088 - Compounds having three or more nucleosides or nucleotides
• A61K 48/00 - Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
• A61P 1/16 - Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
• A61P 3/06 - Antihyperlipidemics

Abstract

[Problem] To provide a penis monitoring device which enables reduction in the burden on a user at the time of monitoring of a change in the penis. [Solution] A penis monitoring device 1 is provided with: an annular member 101 which is a stretchable and shrinkable annular solid member to be fitted around a penis, and of which the electrical properties such as the inductance change in accordance with stretch/shrinkage of the annular member 101; a measurement unit 102 which measures changes in the electrical properties of the annular member 101; and an output unit 103 which outputs information about the result of the measurement by the measurement unit 102. Accordingly, the burden on a user at the time of monitoring of a change in the penis can be reduced.

IPC Classes  ?

• A61B 5/11 - Measuring movement of the entire body or parts thereof, e.g. head or hand tremor or mobility of a limb
• A61B 5/107 - Measuring physical dimensions, e.g. size of the entire body or parts thereof

Abstract

[Problem] To provide an ultrasound observation apparatus with which the inside of a subject can be easily observed. [Solution] An ultrasound observation apparatus is provided with: a storage unit 104 in which at least one distribution information, which is information showing the two-dimensional distribution of Doppler signal components of reflected waves from ultrasonic waves irradiated on a subject, is stored; an acquisition unit 105 for acquiring, using the distribution information, converted distribution information, which is information showing two-dimensional distribution relating to Doppler components of reflected waves in at least one chosen plane; and an output unit 107 for performing output according to the converted distribution information acquired by the acquisition unit 105.

IPC Classes  ?

• A61B 8/06 - Measuring blood flow
• A61B 8/14 - Echo-tomography

Abstract

[Problem] The purpose of the present invention is to provide a new antigenic polypeptide usable as an anti-tumor agent, and an anti-tumor agent containing the polypeptide, in particular, a cancer immunotherapy vaccine. [Solution] The present invention pertains to a polypeptide comprising amino acid sequences a), b), or c), and having the ability to induce cytotoxic T lymphoma (CTL) and/or helper T cells specific to the TWIST1 protein: a) the amino acid sequence represented by SEQ ID NO: 1; b) an amino acid sequence to which one to several tens of arbitrary amino acids have been added to the N-terminal and/or to the C-terminal of the amino acid sequence represented by SEQ ID NO: 1; c) an amino acid sequence in which one or several amino acids have been substituted or deleted, or in which one or several amino acids have been inserted in the amino acid sequence represented by SEQ ID NO: 1. The present invention enables the induction of CTL and/or helper T cells, especially Th1 cells, specific to TWIST1 proteins. Therefore, the polypeptide according to the present invention can be used as an active ingredient in an anti-tumor agent, and in particular as a cancer vaccine.

IPC Classes  ?

• C07K 14/47 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from humans from vertebrates from mammals
• A61K 35/15 - Cells of the myeloid line, e.g. granulocytes, basophils, eosinophils, neutrophils, leucocytes, monocytes, macrophages or mast cells; Myeloid precursor cells; Antigen-presenting cells, e.g. dendritic cells
• A61K 35/17 - Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
• A61K 39/00 - Medicinal preparations containing antigens or antibodies
• A61K 48/00 - Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
• A61P 35/00 - Antineoplastic agents
• A61P 35/04 - Antineoplastic agents specific for metastasis
• C12N 5/0783 - T cells; NK cells; Progenitors of T or NK cells
• C12N 15/09 - Recombinant DNA-technology

Abstract

A composition for photodynamic therapy for treating Helicobacter pylori infections which contains methylene blue and has a pH of 7.6-9.5, a Helicobacter pylori infection treatment method, a system for sterilizing lesions caused by a Helicobacter pylori infection, and a method of operating the system for sterilizing lesions caused by a Helicobacter pylori infection are provided; also provided are a composition for photodynamic therapy for treating mucocutaneous infections which contains methylene blue and has a pH of 7.6-9.5, a mucocutaneous infection treatment method, a system for sterilizing lesions caused by a mucocutaneous infection, and a method of operating the system for sterilizing lesions caused by a mucocutaneous infection.

IPC Classes  ?

• A61K 41/00 - Medicinal preparations obtained by treating materials with wave energy or particle radiation
• A61B 1/00 - Instruments for performing medical examinations of the interior of cavities or tubes of the body by visual or photographical inspection, e.g. endoscopes; Illuminating arrangements therefor
• A61K 31/5415 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and at least one sulfur as the ring hetero atoms, e.g. sulthiame ortho- or peri-condensed with carbocyclic ring systems, e.g. phenothiazine, chlorpromazine, piroxicam
• A61K 47/02 - Inorganic compounds
• A61P 17/00 - Drugs for dermatological disorders
• A61P 31/04 - Antibacterial agents
• A61P 31/10 - Antimycotics

Abstract

[Problem] To provide a highly safe and efficacious antitumor agent that is derived from probiotics. [Solution] The present invention relates to an antitumor agent comprising a compound represented by formula (1) or a complex thereof as an active ingredient. In formula (1): R1 represents a hydrogen atom or a hydroxymethyl group; R2 represents a hydrogen atom, a methyl group or a hydroxymethyl group; and R3, R4 and R5 each independently represent a methyl group, an N5-(trans-5-hydroxy-3-methylpent-2-enoyl) group, an N5-(cis-5-hydroxy-3-methylpent-2-enoyl) group or an N5-(trans-4-carboxy-3-methylpent-2-enoyl) group. According to the present invention, a highly safe and efficacious antitumor agent can be provided.

IPC Classes  ?

• A61K 38/00 - Medicinal preparations containing peptides
• A61P 1/00 - Drugs for disorders of the alimentary tract or the digestive system
• A61P 35/00 - Antineoplastic agents

Abstract

The present invention relates to: an isolated mesenchymal stem cell-like human multipotent stem cell mass characterized by being EphA7-positive; a medical material containing the cell mass; and a method for producing the cell mass, characterized by comprising separating EphA7-positive cells from adherent cells originated from a tissue containing a blood capillary.

IPC Classes  ?

• C12N 5/00 - Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
• A61L 27/00 - Materials for prostheses or for coating prostheses

Abstract

[Problem] To provide an agent for preventing the onset of idiopathic osteonecrosis of the femoral head and/or suppressing the progress of the same. [Solution] An agent for preventing the onset of idiopathic osteonecrosis of the femoral head and/or suppressing the progress of the same, said agent comprising parathyroid hormone or a derivative thereof as an active ingredient, characterized by being intermittently administered.

IPC Classes  ?

• A61K 38/22 - Hormones
• A61P 19/08 - Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease

Abstract

[Problem] To provide an observation assisting device that can appropriately and easily perform observation using excitation light as a light source. [Solution] An observation assisting device provided with: an image capture unit 104 that, using light emitted from a second beam splitter 202 of a microscope 2 capable of interchangeably using as a light source excitation light and observation light that is light including a wavelength other than the excitation light, captures an image of the same observation region as the microscope 2 using each of the excitation light and the observation light as the light source; and an output unit 106 that outputs, by overlapping and combining, images captured by the image capture unit 104 using each of the excitation light and the observation light as the light source.

IPC Classes  ?

• G01N 21/64 - Fluorescence; Phosphorescence

Abstract

In an embodiment, cross sectional image storage stores a cross sectional image group including multiple cross sectional images each of which is associated with time. Phase image storage stores a phase image group including multiple phase images each of which is associated with time. Blood flow information storage stores a blood flow information group including multiple blood flow information each of which is related to blood flow in a blood vessel of the living body and is associated with time. Display synchronously displays a cross sectional image included in the cross sectional image group and a phase image included in the phase image group using time associated with the cross sectional image and the phase image, and displays a blood flow image that expresses multiple blood flow information. The display performs the same change as the change to the cross sectional image, the phase image and the blood flow image.

IPC Classes  ?

• A61B 5/05 - Detecting, measuring or recording for diagnosis by means of electric currents or magnetic fields; Measuring using microwaves or radio waves
• A61B 3/12 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions for looking at the eye fundus, e.g. ophthalmoscopes
• A61B 5/00 - Measuring for diagnostic purposes ; Identification of persons
• G06T 11/60 - Editing figures and text; Combining figures or text
• A61B 5/0285 - Measuring phase velocity of blood waves
• A61B 5/026 - Measuring blood flow
• A61B 3/10 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions
• G01N 21/47 - Scattering, i.e. diffuse reflection

Abstract

In an embodiment, cross sectional image storage stores a cross sectional image group including multiple cross sectional images each of which is associated with time. Phase image storage stores a phase image group including multiple phase images each of which is associated with time. Blood flow information storage stores a blood flow information group including multiple blood flow information each of which is related to blood flow in a blood vessel of the living body and is associated with time. Display synchronously displays a cross sectional image included in the cross sectional image group and a phase image included in the phase image group using time associated with the cross sectional image and the phase image, and displays a blood flow image. The display performs the same change as the change to the change operation to the cross sectional image, the phase image and the blood flow image.

IPC Classes  ?

• A61B 5/05 - Detecting, measuring or recording for diagnosis by means of electric currents or magnetic fields; Measuring using microwaves or radio waves
• A61B 3/12 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions for looking at the eye fundus, e.g. ophthalmoscopes
• A61B 5/00 - Measuring for diagnostic purposes ; Identification of persons
• G06T 11/60 - Editing figures and text; Combining figures or text
• A61B 5/0285 - Measuring phase velocity of blood waves
• A61B 5/026 - Measuring blood flow
• A61B 3/10 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions
• G01N 21/47 - Scattering, i.e. diffuse reflection

Abstract

Provided is a technique for properly performing the blood flow measurement on multiple blood vessels. A blood flow measurement device according to an embodiment is provided with: an image acquisition unit for acquiring an image of a living body; an image region-specifying unit for analyzing the image to specify multiple blood vessel regions; a measurement site setting unit for setting multiple measurement sites that intersect the multiple blood vessel regions; a scanning unit for scanning multiple cross sections in the living body which respectively correspond to the multiple measurement sites by optical coherence tomography; and a blood flow information production unit for producing blood flow information on the living body on the basis of data obtained by the scanning.

IPC Classes  ?

• A61B 3/10 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions
• A61B 3/12 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions for looking at the eye fundus, e.g. ophthalmoscopes
• A61B 5/026 - Measuring blood flow
• A61B 5/0285 - Measuring phase velocity of blood waves
• G01N 21/17 - Systems in which incident light is modified in accordance with the properties of the material investigated

Abstract

Provided are: a composition for photodynamic therapy, which can be used in a photodynamic therapy for treating a mucocutaneous infection such as an infection induced by Helicobacter pylori by bringing the composition into contact with pathogenic microorganisms existing in lesions of the mucocutaneous infection and then irradiating the pathogenic microorganisms with light, said composition comprising methylene blue and at least one pharmaceutically acceptable additive selected from the group consisting of an osmolyte, a reducing agent, urea and a proton donor, and said composition having high safety and an excellent sterilizing effect; and a sterilization method, a sterilization system and a method for operating a sterilization system, in each of which the composition is used.

IPC Classes  ?

• A61K 41/00 - Medicinal preparations obtained by treating materials with wave energy or particle radiation
• A01M 31/00 - Hunting appliances
• A61K 31/375 - Ascorbic acid, i.e. vitamin C; Salts thereof
• A61K 31/4172 - Imidazole-alkanecarboxylic acids, e.g. histidine
• A61K 31/5415 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and at least one sulfur as the ring hetero atoms, e.g. sulthiame ortho- or peri-condensed with carbocyclic ring systems, e.g. phenothiazine, chlorpromazine, piroxicam
• A61K 47/10 - Alcohols; Phenols; Salts thereof, e.g. glycerol; Polyethylene glycols [PEG]; Poloxamers; PEG/POE alkyl ethers
• A61K 47/16 - Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen
• A61K 47/22 - Heterocyclic compounds, e.g. ascorbic acid, tocopherol or pyrrolidones
• A61P 17/00 - Drugs for dermatological disorders
• A61P 31/04 - Antibacterial agents
• A61P 43/00 - Drugs for specific purposes, not provided for in groups

Abstract

The present invention provides: a novel splicing variant of messenger RNA (mRNA) for hepcidin; a protein encoded by the variant; and an antibody against the protein. The present invention also provides: a method for diagnosing cancer utilizing the presence of the variant and the protein as a measure; and a diagnostic agent. A nucleic acid fragment produced by deleting exon 2 in mRNA encoding hepcidin.

IPC Classes  ?

• C12N 15/09 - Recombinant DNA-technology
• C07K 14/435 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from humans
• C07K 16/18 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans
• C12Q 1/68 - Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
• G01N 33/53 - Immunoassay; Biospecific binding assay; Materials therefor
• G01N 33/574 - Immunoassay; Biospecific binding assay; Materials therefor for cancer

Abstract

An optical system splits light into signal light and reference light and detects interference light between scattered light of signal light from living body and reference light. A scanner performs first scan in which first cross section that intersects interested blood vessel is repeatedly scanned with signal light. An image forming part forms first cross sectional image expressing chronological variation of morphology of first cross section and phase image expressing chronological variation of phase difference based on detection results of interference light acquired during first scan. A blood vessel region specifying part specifies blood vessel region corresponding to interested blood vessel for first cross sectional image and phase image. A blood flow information generator generates blood flow information related to interested blood vessel based on blood vessel region of first cross sectional image and chronological variation of phase difference within blood vessel region of phase image.

IPC Classes  ?

• A61B 5/00 - Measuring for diagnostic purposes ; Identification of persons
• A61B 3/12 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions for looking at the eye fundus, e.g. ophthalmoscopes
• G06T 11/60 - Editing figures and text; Combining figures or text
• A61B 5/0285 - Measuring phase velocity of blood waves
• A61B 5/026 - Measuring blood flow
• A61B 3/10 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions
• G01N 21/47 - Scattering, i.e. diffuse reflection

Abstract

[Problem] The present invention addresses the problem of providing an analysis technique relating to the moving image data of a fluorescent contrast agent imaged with a microscope during a procedure, and in particular, to a method and system with which estimation of information such as BV, BF and MTT, vascular wall thickness, and the like is possible, even by fluorescent contrast agent analysis, by applying, to fluorescent contrast agent analysis, perfusion analysis methods with which estimation of information such as BV, BF, and MTT is possible.[Solution] This method for image processing of intravascular hemodynamics is characterized in that by using infrared light, moving image imaging is carried out of a portion of a vessel, as the subject of imaging, into which a specific amount of fluorescent contrast agent has been injected, the shape of the curve representing changes over time in the brightness of the image output of the moving image imaging is subjected to image analysis, and the blood volume or the volume of blood flow as non-constant data is calculated on the basis of the results of the image analysis.

IPC Classes  ?

• A61B 5/026 - Measuring blood flow
• A61B 5/0265 - Measuring blood flow using electromagnetic means, e.g. electromagnetic flow meter
• A61B 5/0275 - Measuring blood flow using tracers, e.g. dye dilution
• A61B 10/00 - Other methods or instruments for diagnosis, e.g. for vaccination diagnosis; Sex determination; Ovulation-period determination; Throat striking implements
• G01N 21/64 - Fluorescence; Phosphorescence

Abstract

[Problem] To provide a mammal repellent for wild animals, harmful animals, livestock animals, etc., which can volatilize and act on the accessory olfactory bulb of wild animals or harmful animals to thereby exert an instinctive effect, like a pheromone, on the wild animals or harmful animals and make the animals to avoid the same. Thus, the mammal repellent is expected to establish an excellent repellent effect in a concentration independent manner. Since human adults have no accessory olfactory bulb, moreover, the mammal repellent can be very easily handled compared with the conventional mammal repellents for wild animals or harmful animals. [Solution] A repellent for mammals having the accessory olfactory bulb, said repellent comprising a pyrazine compound as an active ingredient.

IPC Classes  ?

• A01N 43/60 - 1,4-Diazines; Hydrogenated 1,4-diazines
• A01M 29/12 - Scaring or repelling devices, e.g. bird-scaring apparatus using odoriferous substances, e.g. aromas, pheromones or chemical agents
• A01P 17/00 - Pest repellants

Abstract

The present invention pertains to: a technique for promoting stabilization and maturation of new blood vessels, and for safely and simply inducing the differentiation of cells that bring about ischemia and tissue repair from mononuclear cells; and a cell group obtained according to such a technique. The cells of the present invention: induce differentiation of mononuclear cells by using a medium (in particular, a serum-free medium) containing VEGF, bFGF and a clinically-available cMpl agonist for incubation; and can be adjusted by recovering a group of cells in which CD11b is expressed.

IPC Classes  ?

• C12N 5/078 - Cells from blood or from the immune system
• A61K 35/14 - Blood; Artificial blood
• A61K 35/28 - Bone marrow; Haematopoietic stem cells; Mesenchymal stem cells of any origin, e.g. adipose-derived stem cells
• A61K 35/44 - Vessels; Vascular smooth muscle cells; Endothelial cells; Endothelial progenitor cells
• A61K 49/00 - Preparations for testing in vivo
• A61P 9/10 - Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
• C12N 5/077 - Mesenchymal cells, e.g. bone cells, cartilage cells, marrow stromal cells, fat cells or muscle cells
• C12Q 1/02 - Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving viable microorganisms

Abstract

[Problem] To provide a surgical device which can be used for determination of an excision range and function monitoring in a neurosurgical operation. [Solution] A fence post (1) with an electrode is used for indicating the boundary of an excision region in a brain operation, and is provided with a cylindrical member (11) in which a pointer can be inserted, an electrode (12) which is provided at one end of the cylindrical member (11), and a cable (13) which is connected to the electrode (12) and disposed along the length direction of the cylindrical member (11), thereby making it possible to indicate the boundary of the excision region and be used for function monitoring for searching for a pyramidal tract.

IPC Classes  ?

• A61B 19/00 - Instruments, implements or accessories for surgery or diagnosis not covered by any of the groups A61B 1/00-A61B 18/00, e.g. for stereotaxis, sterile operation, luxation treatment, wound edge protectors(protective face masks A41D 13/11; surgeons' or patients' gowns or dresses A41D 13/12; devices for carrying-off, for treatment of, or for carrying-over, body liquids A61M 1/00)
• A61B 5/0408 - Electrodes specially adapted therefor
• A61B 5/0478 - Electrodes specially adapted therefor
• A61B 5/0492 - Electrodes specially adapted therefor, e.g. needle electrodes

Abstract

[Problem] To provide an image processing device for obtaining a high-quality image. [Solution] The image processing device comprises: a pixel value acquiring means (121) for acquiring the pixel value of a new pixel by using the pixel values of a plurality of original pixels of a first image around a position where the new pixel is disposed, the new pixel being obtained by increasing the resolution of the first image; a representative value acquiring means (122) for acquiring a representative value of the pixel values of a plurality of new pixels disposed in each region where each original pixel is disposed; a correction value acquiring means (123) for acquiring a correction value from the pixel value of each original pixel and the representative value obtained in the region where each original pixel is disposed; and a pixel value correction means (124) for correcting the pixel value of each original pixel by using the correction value. The above correction processing for correcting the original pixels is repeated one time or two or more times, and the pixel values of the original pixels corrected by repetition are used to acquire a second image that is constituted by the new pixels having the pixel values acquired by the pixel value acquiring means (121).

IPC Classes  ?

• G06T 3/40 - Scaling of a whole image or part thereof
• A61B 6/00 - Apparatus for radiation diagnosis, e.g. combined with radiation therapy equipment

Abstract

An objective of the present invention is to carry out a circulatory measurement with a high degree of reliability. An optical image measurement device of an embodiment comprises an optical assembly, a scanning unit, an image forming unit, a blood vessel region identification unit, and a circulatory information generation unit. The optical assembly segments light from a light source into a signal beam and a reference beam, and detects a coherent light of scattered light of the signal beam from a lifeform and the reference beam which is routed via a reference beam path. The scanning unit carries out a first scan in which a first cross-section which intersects with a blood vessel of interest of the lifeform is repeatedly scanned with the signal beam. On the basis of the result of the detection of the coherent light which is obtained in the first scan by the optical assembly, the image forming unit forms a first tomographic image which represents a time series change of a form in the first cross-section and a phase image which represents a time series change of a phase difference. The blood vessel region identification unit identifies a blood vessel region corresponding to the blood vessel of interest for both the first tomographic image and the phase image. The circulatory information generation unit generates circulatory information relating to the blood vessel of interest on the basis of the blood vessel region of the first tomographic image and the time series change of the phase difference in the blood vessel region of the phase image.

IPC Classes  ?

• A61B 3/10 - Objective types, i.e. instruments for examining the eyes independent of the patients perceptions or reactions
• A61B 5/026 - Measuring blood flow
• A61B 5/0285 - Measuring phase velocity of blood waves
• G01N 21/17 - Systems in which incident light is modified in accordance with the properties of the material investigated

Abstract

The present invention provides an immortalized vascular endothelial cell line, an immortalized pericyte cell line and an immortalized mesenchymal stem cell-like pericyte cell line, each of these cell lines being derived from capillary vessels of a nonhuman mammal, and methods for preparing the same.

IPC Classes  ?

• C12N 5/10 - Cells modified by introduction of foreign genetic material, e.g. virus-transformed cells
• C12N 5/071 - Vertebrate cells or tissues, e.g. human cells or tissues
• C12N 5/077 - Mesenchymal cells, e.g. bone cells, cartilage cells, marrow stromal cells, fat cells or muscle cells
• A61K 35/12 - Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
• A61P 9/00 - Drugs for disorders of the cardiovascular system
• A61P 43/00 - Drugs for specific purposes, not provided for in groups
• C12N 15/09 - Recombinant DNA-technology

Abstract

The present invention provides an intestinal tract protective agent comprising a polyphosphoric acid or a pharmaceutically acceptable salt thereof as an active ingredient.

IPC Classes  ?

• A61K 35/747 - Lactobacilli, e.g. L. acidophilus or L. brevis
• A61K 33/42 - Phosphorus; Compounds thereof
• A23L 2/52 - Adding ingredients
• A23L 33/16 - Inorganic salts, minerals or trace elements
• A23L 33/10 - Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
• A23L 33/135 - Bacteria or derivatives thereof, e.g. probiotics

Abstract

Provided is image processing equipment capable of easily establishing appropriate regions of interest in cross-sectional images. The equipment is provided with: a cross-sectional image-storing unit (11) in which multiple cross-sectional images correlated with the acquisition position sequence are stored; an operation-accepting unit (12) that accepts the operation of specifying a single cross-sectional image; a region of interest-establishing information-storing unit in which is stored region of interest-establishing information for establishing one or more regions of interest in the specified cross-sectional image, which is the cross-sectional image that has been specified; an evaluation value-acquiring unit (15) that acquires, using measured values, an evaluation value for evaluating the region of interest for each region of interest indicated by the region of interest-establishing information for the specified cross-sectional image, and acquires, using measured values, a related evaluation value for evaluating each region, in one or more cross-sectional images other than the specified cross-sectional image, that corresponds to each region of interest indicated by the region of interest-establishing information; and an output unit (16) that outputs the acquired evaluation value and related evaluation value correlated with the specified cross-sectional image corresponding to the evaluation value and the cross-sectional image corresponding to the related evaluation value.

IPC Classes  ?

• A61B 5/00 - Measuring for diagnostic purposes ; Identification of persons

Abstract

Disclosed is a water-insoluble polymeric iron chelating agent characterized by having a polymer backbone and an aromatic ring which is bound to the polymer backbone through a bond -NH-CH2-, wherein the aromatic ring has one or two first functional groups each of which is a hydroxy group and one or two second functional groups each of which is selected from a hydroxy group, a carboxylic acid group and a functional group represented by formula (I) [wherein A represents -CH3, -CH2-CH3, -CH2-C6H5, -CH2-C5H4N or -CH2-COOH; and B represents -CH2-COOH], and each of the second functional groups is located at an ortho-position relative to at least one of the first functional groups. This water-insoluble polymeric iron chelating agent has the advantage that the chelating agent can selectively chelate an iron ion, particularly biologically instable iron and that the chelating agent is insoluble in water and therefore cannot be incorporated into a metabolic process in vivo.

IPC Classes  ?

• A61K 31/722 - Chitin; Chitosan
• A61P 3/12 - Drugs for disorders of the metabolism for electrolyte homeostasis
• A61P 13/12 - Drugs for disorders of the urinary system of the kidneys
• A61P 39/04 - Chelating agents

Abstract

The present invention relates to highly functionalized stem cells/progenitor cells, such as vascular endothelial progenitor cells and mesenchymal stem cells having improved functions such as angiogenesis by enhanced Ape1 expression, and a revascularization treatment method using same.

IPC Classes  ?

• C12N 5/10 - Cells modified by introduction of foreign genetic material, e.g. virus-transformed cells
• A61K 9/70 - Web, sheet or filament bases
• A61K 35/28 - Bone marrow; Haematopoietic stem cells; Mesenchymal stem cells of any origin, e.g. adipose-derived stem cells
• A61K 35/34 - Muscles; Smooth muscle cells; Heart; Cardiac stem cells; Myoblasts; Myocytes; Cardiomyocytes
• A61K 35/44 - Vessels; Vascular smooth muscle cells; Endothelial cells; Endothelial progenitor cells
• A61P 9/10 - Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
• A61P 35/00 - Antineoplastic agents
• C12N 5/07 - Animal cells or tissues
• C12N 15/09 - Recombinant DNA-technology

Abstract

Disclosed is an intestinal protectant containing polyphosphoric acid or a pharmaceutically acceptable salt thereof as an active ingredient.

IPC Classes  ?

• A61K 33/42 - Phosphorus; Compounds thereof
• A61K 35/74 - Bacteria
• A61P 1/04 - Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
• A61P 43/00 - Drugs for specific purposes, not provided for in groups

Abstract

Disclosed is an emergency medical support device for suitably determining whether an emergency patient can be accepted. The emergency medical support device is provided with a bed determination unit (104) for determining availability of beds using hospital facility information comprising the number of beds available in rooms for accepting an emergency patient and patient information, including the number of patients of the rooms for accepting the emergency patient, that has been received by a patient information receiving unit (101); a medical team determination unit (109) for determining, upon reception of an acceptance request, whether a medical team capable of dealing with the emergency patient is available using doctor static information comprising a doctor identifier group and doctor dynamic information including doctor identifiers received from wireless communication devices of doctors present in an area in which medical service is to be performed for the emergency patient; and an availability transmission unit (110) for transmitting information indicating availability to an external device if the bed determination unit (104) has determined that a bed is available and the medical team determination unit (109) has determined that a medical team capable of dealing with the emergency patient is present.

IPC Classes  ?

• G06Q 10/00 - Administration; Management

Abstract

Provided is a technique for safely and easily inducing differentiation, from mononuclear cells, of cells that promote stabilization and maturation of new blood vessels and that ameliorate ischemia and repair tissues. Differentiation into said cells is induced by culturing mononuclear cells using a culture medium (in particular, a serum-free medium) that contains one or more of the following: vascular endothelial growth factor (VEGF), basic fibroblast growth factor (bFGF), thrombopoietin (TPO), granulocyte-colony stimulating factor (G-CSF), and FMS-like tyrosine kinase 3 ligand (FLT3L). Cells expressing CD11b are then collected.

IPC Classes  ?

• C12N 5/0786 - Monocytes; Macrophages
• A61K 35/14 - Blood; Artificial blood
• A61P 9/10 - Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
• A61P 9/14 - Vasoprotectives; Antihaemorrhoidals; Drugs for varicose therapy; Capillary stabilisers