The present invention relates to a water purification system comprising a tank connected to a heater, the tank being designed to store a fluid previously heated in the heater, and an ultrasonic transducer disposed inside the tank. The ultrasonic transducer is designed to convert the liquid fluid into steam. The invention also relates to an entropy sensor disposed inside the tank and designed to detect a value corresponding to the multiscale entropy of cavities generated in the tank, and a vacuum pump connected to the tank, wherein the vacuum pump is designed to generate negative pressure that allows the steam from the fluid in the tank to be extracted.
In some embodiments, the present disclosure relates to a method for generating a prognosis. The method may be performed by providing one or more digitized biopsy images of a patient having a glioma. One or more necrotic regions and one or more non-necrotic regions are identified within the one or more digitized biopsy images using a first deep learning algorithm. A second deep learning algorithm is applied to the one or more non-necrotic regions to identify glioblastoma multiforme (GBM) histopathological indicators within the one or more non-necrotic regions.
The present invention relates to a device and a method for collecting and analysing thermodynamic asymmetry data on nipples. The device comprises a computing unit and a first temperature sensor and a second temperature sensor both connected to a computing unit. The temperature sensors are operationally arranged to measure the temperature of the nipples of an individual's breasts. The computing unit controls the first temperature sensor and the second temperature sensor, allowing thermodynamic asymmetry of the nipples to be measured and stored in a thermodynamic asymmetry datum of the nipples. The computing unit subtracts the temperature data, storing it in a thermodynamic asymmetry datum.
The invention relates to a method and apparatus for locating Improvised Explosive Devices (IEDs) buried below the ground surface. The apparatus employs one rapid neutron-emitting radioactive source and two slow neutron detectors. As the materials currently used in the manufacture of IEDs are essentially of a low atomic number, also present in the ground, but generally in concentrations different from those of the IEDs, when a volume of ground is examined by rapid neutrons, the detection of a local variation in the intensity of the slow neutron signal is indicative of the possible presence of explosive material. The method includes numerical analysis procedures and procedures for comparison with previously constructed databases, which enable: (i) The determination, with sufficient accuracy, of the position of the explosive material on a plane parallel to the ground surface. (ii) The obtaining of a statistical assessment of the probability that the object located is an IED.
F41H 11/136 - Systèmes magnétiques, électromagnétiques, acoustiques ou systèmes à rayonnement, p. ex. radars pénétrant dans le sol ou détecteurs de métaux
F41H 11/16 - Véhicules de déminage à autopropulsionDispositifs de déminage pouvant être fixés à des véhicules
The present invention provides designing and synthesizing monomer, polymer, or multimer and formulations of amino-acid chains and peptides from SARS-CoV-2 which are subjected to specific peptide-backbone modifications after being screened by a rational selection which has proven to be highly antigenic and immunogenic useful for human antibody detection and stimulation in higher vertebrates as vaccine components. The so obtained peptides have a common functional motif of formula I:
The present invention provides designing and synthesizing monomer, polymer, or multimer and formulations of amino-acid chains and peptides from SARS-CoV-2 which are subjected to specific peptide-backbone modifications after being screened by a rational selection which has proven to be highly antigenic and immunogenic useful for human antibody detection and stimulation in higher vertebrates as vaccine components. The so obtained peptides have a common functional motif of formula I:
2
NH
-
AA
1
-
AA
2
-
AA
3
-
(
AA
)
n
-
1
-
(
AA
)
n
-
COX
Formula
I
The present invention provides designing and synthesizing monomer, polymer, or multimer and formulations of amino-acid chains and peptides from SARS-CoV-2 which are subjected to specific peptide-backbone modifications after being screened by a rational selection which has proven to be highly antigenic and immunogenic useful for human antibody detection and stimulation in higher vertebrates as vaccine components. The so obtained peptides have a common functional motif of formula I:
2
NH
-
AA
1
-
AA
2
-
AA
3
-
(
AA
)
n
-
1
-
(
AA
)
n
-
COX
Formula
I
where X represents either a —CO—NH2 or a -COOH function, AA is any amino-acid, AA1 is the N-terminus amino-acid residue of a peptide fragment and AAn represents the C-terminus residue of peptide chain from 4 to 30 residues included but are not limited to any peptide sequence are either the 20 genetically coded L-amino-acids or their D-enantiomers even those named non-natural amino-acids as well as peptide-bond isostere forms on specific sequence sites.
A61K 39/215 - Coronaviridae, p. ex. virus de la bronchite infectieuse aviaire
C12Q 1/6888 - Produits d’acides nucléiques utilisés dans l’analyse d’acides nucléiques, p. ex. amorces ou sondes pour la détection ou l’identification d’organismes
C07K 14/165 - Coronaviridae, p. ex. virus de la bronchite infectieuse aviaire
A61P 31/14 - Antiviraux pour le traitement des virus ARN
6.
SUBSTANCE FOR THE BONDING OF GLASS-CERAMICS BY MEANS OF SURFACE IONIC DIFFUSION AND METHOD FOR FUNCTIONALISING SAID CERAMICS
Dental treatment with ceramic restorations including a cementation process, which allows permanent attachment to the tooth or metal abutment by means of a cementing agent. The invention relates to a four-component substance and a method or process in a furnace for dental ceramics. The substance interacts with the ceramic surface by means of a process of ionic diffusion in the presence of heat. This substance is intended to avoid the need for preliminary surface treatments on the ceramic, because these surface treatments increase surface energy by changing the physical or chemical microstructure of the ceramic, allowing interaction with the cement applied.
The present invention relates to a method for manufacturing a lamellar type I collagen support consisting of two zones with different pore orientation (unidirectional and multidirectional) which, when folded from the unidirectional zone towards the multidirectional zone, forms a nerve conduit containing a cylindrical collagen I matrix with pores forming unidirectional channels on the inside and a multidirectional wrapping on the outside. The unidirectional phase promotes and directs axonal growth, and the multidirectional phase controls nutrient flow and prevents cell migration that blocks axonal growth. It also relates to the conduit resulting from folding the support, which is indicated in the treatment of peripheral nerve injuries. The novelty of this conduit lies in the fact that, during surgery, it can be adjusted to the exact diameter of the stumps caused by the lesion and to the length of the discontinuity being treated.
A61L 17/08 - Matériaux au moins partiellement résorbables d'origine animale, p. ex. catgut, collagène
A61L 27/50 - Matériaux caractérisés par leur fonction ou leurs propriétés physiques
A61F 2/00 - Filtres implantables dans les vaisseaux sanguinsProthèses, c.-à-d. éléments de substitution ou de remplacement pour des parties du corpsAppareils pour les assujettir au corpsDispositifs maintenant le passage ou évitant l'affaissement de structures corporelles tubulaires, p. ex. stents
8.
METHOD FOR OBTAINING INTEGRAL CARBON MONOLITHS AND CARBON MONOLITHS OBTAINED
CONSEJO SUPERIOR DE INVESTIGACIONES CIENTÍFICAS (CSIC) (Espagne)
UNIVERSIDAD DE SEVILLA (Espagne)
UNIVERSIDAD NACIONAL DE COLOMBIA (Colombie)
Inventeur(s)
Centeno Gallego, Miguel Ángel
Santos Muñoz, José Luis
Odriozola Gordon, José Antonio
Díaz Velásquez, José De Jesús
Agámez Pertuz, Yazmin Yaneth
Rodríguez Riaño, Nicolás
Abrégé
The present invention relates to a method for preparing integral carbon monoliths, which uses a synthetic resorcinol–formaldehyde polymer together with a polymer of natural origin, such as soluble starch, as a binding agent of carbon materials of different natures. Thus, a process is achieved that allows structured carbon monoliths to be obtained, with and without mineral matter, encompassing a wide range of carbon sources and multiple geometries, by implementing the design and production of extrusion moulds using 3D printing.
B01J 20/00 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation
The invention provides a series of peptides with N-methyl-D-aspartate (NMDA) receptor modulating activity. Specifically it contains two synthetic peptides acting as ion inflow antagonists through the NMDA receptor with specificity GluN2B and GluN2A NMDA receptor subunits and a peptide having agonist activity regarding the NMDA receptor in rat hippocampal neuron cultures.
The invention provides an in vitro method for the determination of sun protection factor (SPF), in order to gain reproducibility and accuracy and replace the use of tests on living beings. Natural substrates of the human skin, like hyaluronic acid are tested in the form of solutions or in the form of a solid film in a modified spectrophotometer, at concentrations below 1% w/v. Once calibrated, the method is used to corroborate the protection factor offered by commercial sunscreens.
G06F 17/40 - Acquisition et consignation de données
G01N 21/33 - CouleurPropriétés spectrales, c.-à-d. comparaison de l'effet du matériau sur la lumière pour plusieurs longueurs d'ondes ou plusieurs bandes de longueurs d'ondes différentes en recherchant l'effet relatif du matériau pour les longueurs d'ondes caractéristiques d'éléments ou de molécules spécifiques, p. ex. spectrométrie d'absorption atomique en utilisant la lumière ultraviolette
G01N 21/77 - Systèmes dans lesquels le matériau est soumis à une réaction chimique, le progrès ou le résultat de la réaction étant analysé en observant l'effet sur un réactif chimique
G01N 21/17 - Systèmes dans lesquels la lumière incidente est modifiée suivant les propriétés du matériau examiné
G01N 21/75 - Systèmes dans lesquels le matériau est soumis à une réaction chimique, le progrès ou le résultat de la réaction étant analysé
The present invention relates to devices for the mode conversion of signals in an optical fibre. The devices disclosed herein comprise a few-mode optical fibre, electrodes disposed along the optical fibre, and electrothermal modulators used to control the electric current through the electrodes. When current passed through the electrodes, they heat up and rise in temperature. The thermal expansion coefficient of the electrodes is such that, when their temperature is varied, they induce the elastooptical effect in the core of the optical fibre, thereby generating a change in the refractive index. This change in the optical properties of the optical fibre allows the spatial modes of the light inside the optical fibre to be changed in a controlled and reversible manner, thereby facilitating modal conversion.
The present invention relates to a method for detecting power transmission lines in an image captured by means of a camera installed in an unmanned aerial vehicle (UAV), the method allowing the autonomous navigation of the vehicle in order to monitor the path of the power transmission line. For this purpose, a two-step image processing system is proposed, the first step detecting the lines in the image and the second step monitoring the lines in real time using a state estimation filter.
B64C 39/02 - Aéronefs non prévus ailleurs caractérisés par un emploi spécial
G05D 1/00 - Commande de la position, du cap, de l'altitude ou de l'attitude des véhicules terrestres, aquatiques, aériens ou spatiaux, p. ex. utilisant des pilotes automatiques
G05D 1/10 - Commande de la position ou du cap dans les trois dimensions simultanément
G06T 1/00 - Traitement de données d'image, d'application générale
G06T 1/20 - Architectures de processeursConfiguration de processeurs p. ex. configuration en pipeline
The present invention relates to a method for identifying oil palm plants (Elaeis guineensis Jacq.) predisposed to bud rot (BR). The method involves extracting total nucleic acids from the apical tissue of the oil palm and processing and analysing same to identify a specific receptor involved in the susceptibility of the plants to BR. The method of the invention surprisingly allows early, rapid and simple identification of oil palm plants susceptible to BR.
The present invention relates to a method for obtaining a physical model of a three-dimensional object from a digital model of the object. The method disclosed herein consists in sectioning the digital model into developable surfaces, and in obtaining images of the object that correspond to each of the surfaces. Subsequently, each image is printed on a two-dimensional surface and adhered to a volume associated with same, so that internal and external sections of the original object are reproduced. The invention also describes the physical model obtained using the disclosed method, which comprises the printed images corresponding to each developable surface and the volumes associated with same that form the physical model. The method of the invention allows access to detailed images of the inside and outside of any object, without needing to acquire and use specialised software. The physical model facilitates interaction with the internal structure of the object, having clinical, didactic and educational advantages.
B33Y 30/00 - Appareils pour la fabrication additiveLeurs parties constitutives ou accessoires à cet effet
B33Y 50/00 - Acquisition ou traitement de données pour la fabrication additive
B33Y 80/00 - Produits obtenus par fabrication additive
B29C 64/00 - Fabrication additive, c.-à-d. fabrication d’objets en trois dimensions [3D] par dépôt additif, agglomération additive ou stratification additive, p. ex. par impression en 3D, stéréolithographie ou frittage laser sélectif
B29C 64/141 - Procédés de fabrication additive n’utilisant que des matériaux solides
B29C 64/147 - Procédés de fabrication additive n’utilisant que des matériaux solides utilisant des matériaux stratifiés, p. ex. fabrication d’objets stratifiés ou matériau stratifié prédécoupé selon les sections en coupe de l’objet en 3D
B29C 67/00 - Techniques de façonnage non couvertes par les groupes , ou
A61C 13/00 - Prothèses dentairesLeurs procédés de fabrication
15.
SHORT LEOPEPTIDES WITH ANTIMICROBIAL ACTIVITY AGAINST GRAM NEGATIVE AND GRAM POSITIVE BACTERIA
n1232 n12123 Staphylococcus aureus, Enterococcus faecalis, Escherichia coli, Pseudomonas aeruginosa, Klebsiella pneumoniae, Acinetobacter baumannii, Serratia marcescens, Staphylococcus saprophyticus, Staphylococcus haemolyticus and Streptococcus salivariusStaphylococcus aureus, Enterococcus faecalis, Escherichia coli, Pseudomonas aeruginosa, Klebsiella pneumoniae, Acinetobacter baumannii, Serratia marcescens, Staphylococcus saprophyticus, Staphylococcus haemolyticus and Streptococcus salivarius), at minimum inhibitory concentrations (MIC) between 8 and 50 µM. In addition, they do not display toxicity in human red blood cells or in mosquito larvae in concentrations between 3.13 and 50.0 µM at an evaluated concentration of 100 µM.
The invention relates to a plenoptic ocular device (1) intended to be coupled in an ocular port of an optical instrument configured to generate a real image of a sample on a focal plane situated in a region close to said ocular port, said plenoptic ocular device being configured to capture said real image, generate a set of elemental images and send them to recording means with spatial discretisation (8) which in turn comprises communication means configured to transmit the set of elemental images to external image processing means. The plenoptic ocular device (1) comprises a tubular element (2), a coupling element (3), a diaphragm (4), a first lens arrangement (5), a second lens arrangement (6), a lens array (7) and a recording means with spatial discretisation (8).
The present invention provides a method for producing oncolytic rotaviruses from parental rotaviruses and tumour lines of any origin, with the ability to infect and lyse tumour cells in vitro and in vivo, the cell membranes of which express integrin proteins (αβ3), protein disulfide isomerase (PDI) proteins, heat-shock proteins (Hsp90, Hsp70, Hsp60 or Hsp70). Moreover, the present invention provides a method for treating neoplasms in an animal comprising the administration of oncolytic rotaviruses, selected and adapted to tumour cells, in carrier cells in vitro, and subsequent administration thereof to the animal. The method for administering the oncolytic rotaviruses in carrier cells allows recognition by antibodies to be avoided and release of the rotavirus in tumour cells, thereby infecting same.
The invention relates to a device for acquiring data in bodies of water comprising a sealed casing having a first element with a first threaded end and a second threaded end, a second element with a first threaded end and a second threaded end, wherein the threaded end is operationally connected to the threaded end of the first element. Also provided is a cover connected to the second threaded end of the second element, an element having a sensor inside same, wherein said element is connected to the second threaded end of the element. There is also a computer unit inside the first element and connected to the sensor, a battery inside the element and connected to the computer unit, and a wireless communication module inside the first element and connected to the computer unit. Said computer unit receives signals from the sensor and the signals from the wireless communication module, and is connected to the battery, and the sensor does not protrude from the casing.
The invention relates to a screw for dental implants, the geometry of which was designed using nine parameters (diameter, length, body angle, pitch, crown thread angle, apical thread angle, apical roundness, thread width and thread depth) which make it possible to calculate the distribution of the mechanical load thereof. This geometry makes it possible to distribute the forces in order to optimise bone remodelling and simultaneously to improve osseointegration.
A61C 8/00 - Moyens destinés à être fixés à l'os de la mâchoire pour consolider les dents naturelles ou pour y assujettir des prothèses dentairesImplants dentairesOutils pour l'implantation
20.
POLYELECTROLYTIC COMPLEX WITH ANTIMICROBIAL ACTIVITY
The present invention provides a solution to the drawbacks of cosmetic preservatives by designing a preservative system that is able to slowly release the molecule with antimicrobial activity and is soluble and active in aqueous media at a pH higher than 5, which is the pH generally found for products with cosmetic applications. To arrive at said solution, the principles of complex formation between small molecules of an electrolytic nature, for example the preservative benzoic acid and cationic polyelectrolytes, of a basic nature, in which new chemical entities are obtained via chemical (especially ionic) interactions, were used.
A01N 37/10 - Acides carboxyliques aromatiques ou araliphatiques, ou leurs thio-analoguesLeurs dérivés
A61K 8/368 - Acides carboxyliquesLeurs sels ou anhydrides dans lesquels le groupe carboxyle est directement lié aux atomes de carbone du cycle aromatique
Thin films of nickel-copper binary oxynitride (NiCuOxNy) were deposited on the surface of substrates of AISI 3161 stainless steel and glass using reactive RF sputtering, with a thickness between 700 and 2100 nm, under various depositing conditions, from a bimetallic nickel-copper precursor target, using specific conditions such as: base pressure, working pressure, argon flow, oxygen flow, nitrogen flow, strength of the Ni-Cu precursor target, target-substrate distance, and depositing time. The films were characterised and a preliminary study of biocompatibility and characterisation in terms of the optical properties thereof was carried out
The invention describes a method for determining sun protection factor (SPF) in vitro in order to achieve reproducibility and precision in the determinations and to replace the use of testing on living beings. For this purpose, hyaluronic acid, a natural substrate present on human skin, is used, which is tested in solution or as a solid film in concentrations below 1% w/v, using a spectrophotometer. Once calibrated, the method can be used to check the protection factor offered by commercial sun blocks.
G01N 21/33 - CouleurPropriétés spectrales, c.-à-d. comparaison de l'effet du matériau sur la lumière pour plusieurs longueurs d'ondes ou plusieurs bandes de longueurs d'ondes différentes en recherchant l'effet relatif du matériau pour les longueurs d'ondes caractéristiques d'éléments ou de molécules spécifiques, p. ex. spectrométrie d'absorption atomique en utilisant la lumière ultraviolette
23.
Cement formulation based on aluminium sulphate with a specific proportion of Ye'elimite systems
The present invention corresponds to a cement formulation based on sulfoaluminate comprising a specific Ye'elimite crystal proportion having enhanced mechanical resistance, setting and low CO2 emission features. A concrete obtained when mixing said formulation with water and gypsum is further described, having a superior performance at initial ages compared to concrete obtained from Portland cement.
C04B 28/16 - Compositions pour mortiers, béton ou pierre artificielle, contenant des liants inorganiques ou contenant le produit de réaction d'un liant inorganique et d'un liant organique, p. ex. contenant des ciments de polycarboxylates contenant des ciments de sulfate de calcium contenant de l'anhydrite
The invention relates to a method for obtaining a biocide extract from microorganisms of the Bacillus sp, Serratia sp, Pseudomonas sp, Burkholderia sp, Brevundimonas sp, Escherichia sp, Delftia sp, Acinetobacter sp, Photorhabdus sp or Xenorhabdus sp genera, comprising isolation and purification of the microorganism, preparation of a pre-inoculum, inoculation in the presence of an adsorbent resin, and, finally, separation and elution of the resin with an organic solvent, until a bacterial extract with insecticidal, fungicidal and/or repellent activity is obtained.
A01N 63/02 - Substances produites par, ou obtenues à partir de micro-organismes ou d'animaux
C12P 1/04 - Préparation de composés ou de compositions, non prévue dans les groupes , utilisant des micro-organismes ou des enzymesProcédés généraux de préparation de composés ou de compositions utilisant des micro-organismes ou des enzymes utilisant des bactéries
The invention relates to a system for generating bio-oil from biomass and a process for producing bio-oil from biomass. The system for producing bio-oil from biomass comprises: a mechanism for the continuous supply of biomass; a pyrolyser having a biomass inlet connected to the mechanism for the continuous supply of biomass, and having a mesh; a mechanism for separating solids connected to the pyrolyser; and a condenser connected to the mechanism for separating solids. The process for the production of bio-oil from biomass comprises the following steps: a) continuously supplying biomass to a pyrolyser; b) pyrolysing the biomass at a heating rate of greater than 1000°C/s, to a temperature between 300°C and 750°C, and with a dwell time of less than 2 seconds, in the pyrolyser; c) separating particulate material present in the gases obtained via pyrolysis in step b), in a mechanism for separating solids; and d) condensing the gases obtained via pyrolysis that are condensible to a temperature between -30°C and 0°C, in a condenser.
C10B 49/00 - Distillation destructive des matières carbonées solides par chauffage direct au moyen d'agents porteurs de chaleur, y compris la combustion partielle de la matière à traiter
26.
METHOD FOR PRODUCING SWEETENED SYRUPS FROM AGROINDUSTRIAL WASTE
The invention relates to a method for obtaining sweetened syrups from agroindustrial waste, comprising using physical, biological and chemical methods in order to pre-treat the agroindustrial waste and subjecting same to enzymatic hydrolysis until a glucose-rich sweetened syrup is obtained. Isomers are added to the sweetened syrup in order to obtain syrups comprising mixtures of glucose isomers, which are of great use in the food, cosmetic, pharmaceutical and alternative energy industries.
The invention relates to a method for producing hydrogen by fermenting a substrate obtained form organic waste, performed in a closed environment, without the supply of oxygen and in the absence of light. The method comprises: preparation of the complex substrate; an acidification step under anaerobic conditions and at ambient temperature; and, subsequently, the gradual increase of the pH of the system so as to obtain hydrogen.
The invention relates to a method for the production of concrete mixtures and mortar mixtures. The method comprises the following steps: a) mixing and agitating a cementing agent with water until an activated paste is produced; b) adding a fine aggregate to the activated paste from step (a) and agitating until a mortar mixture is produced; and c) adding a coarse aggregate to the mixture resulting from step (b), and agitating until a concrete mixture is produced. In addition, the invention comprises an activated paste, a mortar mixture and a concrete mixture.
B28C 5/00 - Appareillages ou procédés pour la production de mélanges de ciment avec d'autres substances, p. ex. coulis, mortiers, compositions poreuses ou fibreuses
B28C 5/48 - Appareillages ou procédés pour la production de mélanges de ciment avec d'autres substances, p. ex. coulis, mortiers, compositions poreuses ou fibreuses dans lesquels le mélange est effectué par vibrations
B28C 7/04 - Alimentation ou dosage des ingrédients
C04B 40/00 - Procédés, en général, pour influencer ou modifier les propriétés des compositions pour mortiers, béton ou pierre artificielle, p. ex. leur aptitude à prendre ou à durcir
29.
METHOD FOR OBTAINING AN EXTRACT OF AZADIRACHTA INDICA
The invention relates to a method for obtaining an extract from a cell culture of Neem (Azadirachta indica). The suspended cell culture is subjected to cellular stress under conditions that promote the production of active metabolites such as azadirachtins and terpenoids, which are subsequently extracted with solvents and/or adsorption resins. The extract obtained, whether alone or incorporated into an agrochemical composition, can be used for pest control in different crops.
A01N 65/00 - Biocides, produits repoussant ou attirant les animaux nuisibles, ou régulateurs de croissance des végétaux contenant du matériel provenant d'algues, de lichens, de bryophytes, de champignons multicellulaires ou de plantes, ou leurs extraits
C12P 17/18 - Préparation de composés hétérocycliques comportant O, N, S, Se ou Te comme uniques hétéro-atomes du cycle contenant plusieurs hétérocycles condensés entre eux ou condensés avec un système carbocyclique commun, p. ex. rifamycine
The invention relates to a method for producing avocado-based solid compositions having a high content of total solids coming from the avocado fruit, in addition to a high nutritional value, and being safe from a microbiological perspective, as well as having the colour, flavour and scent of the avocado pulp itself. The produced solid compositions are useful for the food, cosmetic and pharmaceutical sector.
A23B 7/022 - DéshydratationRéhydratation ultérieure avec addition de produits chimiques
A23L 3/40 - Conservation des aliments ou produits alimentaires, en général, p.ex. pasteurisation ou stérilisation, spécialement adaptée aux aliments ou produits alimentaires par séchage ou étuvage; Reconstitution ultérieure
A23L 3/42 - Conservation des aliments ou produits alimentaires, en général, p.ex. pasteurisation ou stérilisation, spécialement adaptée aux aliments ou produits alimentaires par séchage ou étuvage; Reconstitution ultérieure avec addition de produits chimiques avant ou durant le séchage
The invention here claim presents specific sugars and one lectin which block the adherence of Streptococcus to Intestinal epithelium of farmed tilapia. The invention has potential medical and industrial use to prevent Streptococcosis in fish, because Streptococcus agalactiae- specific and - associated to fish have own metabolic ways to use the sugars here described and share these ways with other Streptococcus which affect fish, like S. iniae and S. ictaluri.
A substance aimed at inhibiting the adherence of bacteria affecting the respiratory tract of mammals was developed. This substance is composed of a mixture of carbohydrates that bind to the bacterial adhesins and/or cellular receptors of the host and block the bacteria-host interaction, preventing bacterial adherence to the epithelium and the development of infection.
The present invention provides a series of peptides that modulate the activity of the N-methyl-D-aspartate (NMDA) receptor. Specifically, the invention relates to two synthetic peptides that antagonise ion inflow through the NMDA receptor, with specificity towards the GluN2B and GluN2A subunits of the NMDA receptor, and to a peptide with antagonist activity on the NMDA receptor in cultures of hippocampal neurons from rats.
The present invention relates to a novel synthetic chimeric peptide of 35 amino acids, known as hTip-CSKH, which has a hydrophobic region (hTip), a region for binding to Lck (CSKH) and a short amphipathic region with hydrophobic, charged amino acids. The chimeric peptide is inserted into the plasma membrane, specifically in the so-called lipid rafts, where it modulates the activity of the protein tyrosine kinase, known as Lck, so as to induce its activation and the proliferation of normal immune system cells (lymphocytes) or to inhibit the growth of T-cell leukemias. The peptide is specific for Lck modulation since it uses a binding domain specific to Lck and not to other proteins from the Src family of tyrosine kinase proteins, such as Fyn or Lyn. In addition, the hydrophobic sequence used (hTip) can be used as a vehicle for inhibiting other proteins present in the lipid rafts.
TAHAMI & CULTIFLORES S.A. EN REORGANIZACION (Colombie)
Inventeur(s)
Aristizábal Torres, Iván Darío
Moreno Cárdenas, Edilson León
Abrégé
The invention relates to a machine for transplanting seedlings, which comprises a movable chassis and a transplantation unit. The movable chassis has wheels, and trays containing the seedlings to be transplanted are disposed on the chassis. The transplantation unit is formed by a digging cylinder and a tube that is operatively disposed in the movable chassis so that the digging cylinder makes the holes into which the seedlings are placed and the tube guides the seedlings towards the hole.
A01B 29/06 - Rouleaux comportant des dispositifs accessoires particuliers
36.
METHOD FOR DETERMINING THE THICKNESS OF A THIN LAYER BY MULTI-WAVELENGTH INTERFEROMETRY AND CORRESPONDING COMPUTER PROGRAM PACKAGE, STORAGE MEANS AND SYSTEM
CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE (France)
UNIVERSIDAD NACIONAL DE COLOMBIA (Colombie)
Inventeur(s)
Picart, Pascal
Malek, Mokrane
Garcia-Sucerquia, Jorge
Abrégé
A method and system are provided for determining the thickness of a thin layer deposited on the surface of a reflective substrate, by means of a multi-wavelength device in a configuration equivalent to a Michelson interferometer. The method consists in: generating (20) an array of collimated light beams intended to illuminate the surface of the thin layer and that of the planar mirror, each beam having a distinct wavelength; occulting (21) the measurement arms, preventing the collimated light beams from being received by the object to be measured, and obtaining (22) a reference image representative of the light intensity issued from the planar mirror; occulting (23) the reference arm, preventing the collimated light beams from being received by the planar mirror, and obtaining (24) a measurement image representative of the light intensity issued from the object to be measured; and determining (25) the thickness of the thin layer from the measurement and reference images obtained.
G01B 11/06 - Dispositions pour la mesure caractérisées par l'utilisation de techniques optiques pour mesurer la longueur, la largeur ou l'épaisseur pour mesurer l'épaisseur
37.
CEMENT FORMULATION BASED ON SULFOALUMINATE WITH A SPECIFIC PROPORTION OF YE'ELIMITE SYSTEMS
The invention relates to a cement formulation based on aluminium sulphate comprising a specific proportion of Ye'elimite crystals with improved properties of mechanical resistance, setting and CO2 emissions. The invention also relates to a concrete obtained by mixing said formulation with water and plaster, which performs better during the first stages compared to the concrete obtained from Portland cement.
C04B 28/16 - Compositions pour mortiers, béton ou pierre artificielle, contenant des liants inorganiques ou contenant le produit de réaction d'un liant inorganique et d'un liant organique, p. ex. contenant des ciments de polycarboxylates contenant des ciments de sulfate de calcium contenant de l'anhydrite
38.
POLYMER PACKAGING THAT DELAYS THE RIPENING AND SENESCENCE PROCESS IN FRESH VEGETABLE PRODUCTS
The present invention relates to a polymer composition for absorbing ethylene and other gaseous compounds, which comprises a polymer substrate that consists of polyolefin or a mixture of polyolefins and one or more ethylene capture agents in a concentration between 0.5% and 5%. The invention also relates to a packaging that delays the process of ripening and senescence in fruits, vegetables and foliage and which is characterised in that it contains the above-mentioned composition, and a method for extending the shelf life of said perishable products during transport, storage and sale thereof.
A23B 7/152 - Conservation ou mûrissement à l'aide de produits chimiques non couverts par les groupes ou sous forme de gaz, p. ex. fumigationCompositions ou appareils à cet effet en atmosphère contrôlée comportant d'autres gaz en plus des gaz suivants: CO2, N2, O2 ou H2O
A23L 3/3445 - Conservation des aliments ou produits alimentaires, en général, p.ex. pasteurisation ou stérilisation, spécialement adaptée aux aliments ou produits alimentaires par traitement au moyen de produits chimiques sous forme de gaz, p.ex. fumigation; Compositions ou appareils à cet effet en atmosphère contrôlée comportant d'autres gaz en plus des gaz suivants: CO2, N2, O2 ou H2O
B32B 27/18 - Produits stratifiés composés essentiellement de résine synthétique caractérisée par l'emploi d'additifs particuliers
B65D 81/24 - Adaptations pour empêcher la détérioration ou l'altération du contenuApplications au réceptacle ou au matériau d'emballage d'agents de conservation des aliments, de fongicides, d'insecticides ou de produits repoussant les animaux
39.
PROCESS OF MANUFACTURING MILK CURD AND CHEESE BY DIRECT CHEMICAL ACIDIFICATION
A fast and efficient process to manufacture milk curd by direct chemical acidification with acid. The process comprises the steps of heating the milk to a temperature sufficient to pasteurize the milk, cooling the milk, coagulating the milk with the addition of an acid, and incubating the milk and acid mixture for a set period of time. The resulting curd may be employed in the manufacture of different varieties of cheese to which it is subjected to additional steps of salting, molding and / or pressing.
The invention hereby claimed relates to the field of tissue engineering and concerns a method for isolating type I collagen from rat tail and producing multidirectional scaffolds (Pérez et al., 2001). In recent years, the isolating method has been modified and standardised. Likewise, changes have been introduced into the method for obtaining scaffolds from this collagen and a novel method has been developed for producing unidirectional laminar scaffolds. In the optimised method, the animal collagen source is cleaned, cut and suspended in an acetic acid solution until a liquid phase pH between 2.5 and 3.2 is reached, agitating constantly at 4°C. Said suspension is centrifuged and the pH of the supernatant obtained is neutralised with NaOH in order to re-separate the solid and liquid phases. The collagen precipitated in this way is re-precipitated with salts and solubised in acetic acid, and the solution is poured into moulds, frozen at -20°C and freeze-dried. Lastly, the scaffolds obtained are cross-linked and then sterilised with ethylene oxide.
The present invention discloses a method for the detection and diagnosis of faults in running electric machines. The method consists of: i) simultaneously obtaining a current signal and a voltage signal associated with the rotor winding of the electric machine; ii) defining a group of vectors whose components are DC and/or AC values at different separation and amplification levels of the current and voltage signals; iii) simultaneously obtaining a current signal and a voltage signal associated with an emulated fault; iv) defining a group of vectors whose components are DC and/or AC values at different separation and amplification levels of the current and voltage signals associated with an emulated fault; v) determining the variations in the components of the vectors; vi) comparing the vectors that show component variations with the emulated fault vectors; vii) analyzing the variations and comparisons in order to detect whether or not there is at least one type of fault; and viii) reporting the presence or absence of at least one type of fault in the electric machine.
The present invention also discloses a system to carry out this method, consisting of: i) a unit that obtains the current and voltage signals associated with the winding of the electric machine; ii) a unit that emulates faults; iii) a unit that sensitizes the signals by separating the DC and/or AC levels and amplifies the resulting signal; iv) a memory unit that stores the DC and/or AC values; and v) a unit that processes, analyzes and reports on the status of the machine.
G01R 31/02 - Essai des appareils, des lignes ou des composants électriques pour y déceler la présence de courts-circuits, de discontinuités, de fuites ou de connexions incorrectes de lignes
G01R 31/06 - Essai de bobinage électrique, p.ex. pour déterminer la polarité
G01R 21/00 - Dispositions pour procéder aux mesures de la puissance ou du facteur de puissance
The present invention relates to a diluent for the protection, preservation and cryopreservation of semen. The diluent contains at least one cytoprotective compound derived from isopropylphenol along with cryoprotective agents and coadjuvants that allow for increased sperm motility, vitality and functionality. The presence of isopropylphenols in the diluent of the present invention reduces the oxidative stress on semen by inhibiting the production of reactive oxygen species and by inhibiting lipid peroxidation. The diluent of the invention is very effective in the protection of sperm when they are placed under highly stressful conditions, such as cryopreservation.
This invention discloses a reaction system for producing fatty-acid alkyl esters using liquid film reactors, with countercurrent flow scheme based on the alcoholysis of fats and oils. Reaction system comprises a descending film reactor using semi-structured packing for generating interfacial area. It is fed through the bottom with oil or fat, and with a mixture containing alcohol, glycerol and catalyst through an intermediate stage. Products are a mixture of fatty-acid alkyl esters, alcohol and catalyst and alcohol, glycerol and catalyst, exit via the top and the bottom of the reactor, respectively. Volumetric packing fraction is between 2% and 50%, reaction temperature from 25 to 180° C., molar ratio alcohol to oil between 3:1 and 10:1, and CH3OH, NaOH, KOH, or their mixtures (0.5% to 3% based on the oil mass flow rate). Conversion and yield in a single reaction step are greater than 99.7% and 99.9%, respectively.
C11C 3/00 - Graisses, huiles ou acides gras obtenus par transformation chimique des graisses, huiles ou acides gras, p. ex. ozonolyse
C11C 3/02 - Graisses, huiles ou acides gras obtenus par transformation chimique des graisses, huiles ou acides gras, p. ex. ozonolyse par estérification des acides gras avec la glycérine
C11C 3/04 - Graisses, huiles ou acides gras obtenus par transformation chimique des graisses, huiles ou acides gras, p. ex. ozonolyse par estérification des graisses ou des huiles
C11C 3/06 - Graisses, huiles ou acides gras obtenus par transformation chimique des graisses, huiles ou acides gras, p. ex. ozonolyse par estérification des graisses ou des huiles avec la glycérine
C11C 3/10 - Graisses, huiles ou acides gras obtenus par transformation chimique des graisses, huiles ou acides gras, p. ex. ozonolyse par estérification des graisses ou des huiles par interestérification
C07C 67/03 - Préparation d'esters d'acides carboxyliques par réaction d'un groupe ester avec un groupe hydroxyle
C07C 69/00 - Esters d'acides carboxyliquesEsters de l'acide carbonique ou de l'acide formique halogéné
C07C 69/02 - Esters d'acides acycliques monocarboxyliques saturés dont le groupe carboxyle est lié à un atome de carbone acyclique ou à l'hydrogène
B01J 8/02 - Procédés chimiques ou physiques en général, conduits en présence de fluides et de particules solidesAppareillage pour de tels procédés avec des particules immobiles, p. ex. dans des lits fixes
B01J 19/24 - Réacteurs fixes sans élément interne mobile
B01J 8/00 - Procédés chimiques ou physiques en général, conduits en présence de fluides et de particules solidesAppareillage pour de tels procédés
B01J 19/00 - Procédés chimiques, physiques ou physico-chimiques en généralAppareils appropriés
B01J 19/30 - Éléments de remplissage non agglomérés ou en forme, p. ex. anneaux de Raschig ou éléments de Berl en forme de selle, destinés à être versés dans l'appareil de transfert de chaleur ou de matière
44.
MICROSCOPE, METHOD AND COMPUTER PROGRAM FOR OBTAINING QUANTITATIVE PHASE IMAGES BY MEANS OF DIGITAL HOLOGRAPHIC MICROSCOPY, AND KIT FOR ADAPTING AN OPTICAL MICROSCOPE
The present invention relates to a microscope, method and computer program for obtaining quantitative phase images by means of digital holographic microscopy, and a kit for adapting an optical microscope. The microscope comprises: - a coherent light source (1) and a beam splitter (3) for generating an object beam (Lo) for illuminating a sample, and a reference beam (Lr); - an optical system with a main optical path making up a telecentric afocal system, and a reference optical path; and - recording means (12) recording a hologram of said sample in the image plane of the optical system. The method comprises recording a hologram in the image plane of an optical telecentric afocal system. The computer program is adapted for implementing part of the steps of the method. The kit comprises means for varying the angle of inclination of a reference beam.
G02B 21/14 - Condensateurs donnant un éclairage pour une observation en contraste de phase
G02B 21/36 - Microscopes aménagés pour la photographie ou la projection
G03H 1/00 - Procédés ou appareils holographiques utilisant la lumière, les infrarouges ou les ultraviolets pour obtenir des hologrammes ou pour en obtenir une imageLeurs détails spécifiques
45.
ORTHODONTIC TOOL FOR THE PLACEMENT, POSITIONING AND ATTACHING OF BRACKETS ON THE VESTIBULAR SURFACE OF THE TOOTH
The invention relates to an orthodontic tool for the placement, positioning and attaching of brackets using a direct or indirect method, said tool comprising two parts: a body for manipulating the device (1) and a point (2). The shape of the body (1) is compatible with the hand and offers the user control and comfort when arranging the bracket (100) on the target - the target being the mesiodistal centre of the dental piece or tooth - at a predetermined height (202), resulting in precision and accuracy.
The invention relates to a device and a method for the development and production of crops without soil, based on vaporisation and controlling the energy of the water. The device according to the invention uses two (2) climatically independent chambers, one for foliage and the other for roots. The contact with the environment is controlled in accordance with the thermodynamic conditions inside the chambers and/or requirements of the metabolism of the plants. The energy of the water or nutritive solutions is controlled by means of vaporisation, which is associated, by means of algorithms, with the ventilation and the heating or the cooling.
The present invention discloses a method for the detection and diagnosis of faults in electric machines when in operation. The method comprises: i) simultaneously acquiring a current signal and a voltage signal associated with the winding of the electric machine; ii) defining a set of vectors whose components are DC and/or AC values at different levels of separation and amplification of the current and voltage signals; iii) simultaneously acquiring a current signal and a voltage signal associated with an emulated fault; iv) defining a set of vectors whose components are DC and/or AC values at different levels of separation and amplification of the current and voltage signals associated with an emulated fault; v) identifying variations in the components of the vectors; vi) comparing vectors having variations in their components with respect to the emulated fault vectors; vii) analysing the variations and comparisons in order to detect whether there is at least one type of fault; and viii) reporting the presence or absence of at least one type of fault in the electric machine. The present invention further discloses a system for carrying out the method, comprising: i) a module for obtaining the current and voltage signals associated with the winding of the electric machine; ii) a fault emulation module; iii) a module for sensitizing signals by separating DC and/or AC levels and amplifying the resulting signal; iv) a memory unit for storing data relating to the DC and/or AC values; and v) a module for processing, analysis and reporting the status of the machine.
The invention relates to a method and device for applying electric discharges to sheets in order to perforate same. The method comprises the impregnation or deposition of substances, such as paints, dyes, colouring agents and substances having different degrees of hydrophobicity, in/on the sheets during electric perforation. The perforation device comprises electric perforation means, including a liquid or gel as a conduction medium for the electric discharge and as supports for the sheets, as well as a medium for dissolving or mixing salts, paints, dyes, colouring agents and substances having different degrees of hydrophobicity.
The invention relates to a novel class of synthetic peptides having the amino acid sequence IAPALIAVAPIAKYLATALAKWALKQGFAKLKS (SEQ ID Nº 1) that is at least 90% homologous with SEQ ID Nº 1. The peptides of the invention have ionophoric, antimicrobial, anti-tumour and insecticidal activity. The invention also relates to agricultural and pharmaceutical compositions containing same, which can be used in the inhibition of tumoral and microbial growth..
The present invention discloses a reaction system for producing fatty-acid alkyl esters using packed reactors, particularly liquid-film reactors, with a countercurrent feed current flow scheme based on the alcoholysis of oils and fats, specifically the methanolysis of palm oil and soya oil. The reaction system comprises a descending liquid-film reactor that uses semi-structured packing for generating an interface area. The reactor is fed, separately, with the oil or fat, through the bottom of the reactor, and a mixture containing alcohol, glycerol and catalyst, which may be fed in in an intermediate stage. It is also possible, optionally, to feed in a second stream of the mixture of alcohol, glycerol and catalyst in proportions different from those of the first stream, either in an intermediate stage of the reactor or through the top thereof. The products, a mixture of fatty-acid alkyl esters, alcohol and catalyst, and another of glycerol, alcohol and catalyst, exit via the top and the bottom of the reactor, respectively. The volumetric fraction of packing in the reactor is between 2 and 50%, the operating temperature between 25°C and 180°C, depending on the alcohol used, the molar ratio of alcohol to oil or fat between 3:1 and 10:1, and it is possible for the catalyst to be any homogeneous basic catalyst used in alcoholysis, such as CH3OK, NaOH, KOH, or mixtures thereof, in a proportion of between 0.5% and 3% by weight with respect to the oil flow. The conversion and the yield of the liquid-film reactor operated countercurrentwise, in a single reaction step, are greater than 99.7% and 99.9%, respectively.
The invention relates to a process for obtaining pulp from vegetable waste and to the resulting product. The process comprises the following steps: a) breaking the fibres of the vegetable waste using a mechanical process; b) releasing the treated waste into the environment; c) subjecting the waste to heat treatment; d) drying; e) recovering the liquids extracted during the process. The pulp can be used to produce paper, cardboard or expanded polystyrene substitutes.
CONSEJO SUPERIOR DE INVESTIGACIONES CIENTÍFICAS (CSIC) (Espagne)
UNIVERSIDAD DE SEVILLA (Espagne)
UNIVERSIDAD NACIONAL DE COLOMBIA (Colombie)
Inventeur(s)
Alba Carranza, María Dolores
Castro Arroyo, Miguel Ángel
Orta Cuevas, María Del Mar
Pavón González, Esperanza
Pazos Zarama, Mery Carolina
Abrégé
The present invention relates to a phyllosilicate which includes high-load sheets of expansible micas and, inserted between said sheets, cations of (C12-C18) alkyl-decyl-ammonium. The present invention also relates to the method for adsorbing said cations of alkyl-decyl-ammonium between the sheets of mica, and to the use thereof for decontaminating organic contaminants.
C01B 33/44 - Produits obtenus à partir de silicates échangeurs de base, en couches, par échange d'ions avec des composés organiques tels que des composés ammonium, phosphonium ou sulfonium ou par insertion de composés organiques, p. ex. matériaux organoargiles
C02F 1/42 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par échange d'ions
The present invention relates to a method for obtaining transition-metal catalysts supported on a carbonaceous material via impregnation with a solution from the thiourea metal complex, obtained from the precursor salts. Sulphur is formed on the surface of the substrate by thermal decomposition of the complex. The catalysts obtained by means of the process of the present invention are applicable to the direct liquefaction of carbon.
B01J 27/02 - Soufre, sélénium ou tellureLeurs composés
B01J 37/02 - Imprégnation, revêtement ou précipitation
C10G 1/00 - Production de mélanges liquides d'hydrocarbures à partir de schiste bitumineux, de sable pétrolifère ou de matières carbonées solides non fusibles ou similaires, p. ex. bois, charbon
54.
Lactococcus lactis NRRL B-30656, and preparing the biopolymer
Lactococcus lactis strain (NRRL B-30656) produces an extracellular transferase enzyme when cultured and grown in sucrose-containing medium, which can be purified when it is brought into contact with a sucrose-based medium in suitable temperature and pH conditions, thereby producing a glucose and fructose polymer.
C12P 19/18 - Préparation de composés contenant des radicaux saccharide préparés par action d'une transférase glycosylique, p. ex. alpha-, bêta- ou gamma-cyclodextrines
brevets
