Abrégé

Amorphous silica-alumina support materials are provided that can serve as supports for polyamines. The silica-alumina support materials have a combination of properties that unexpectedly allow supported polyamines to retain an increased or maximized amount of CO2 sorption capacity after incorporation of substantial amounts of the polyamine on the support material. This combination of properties can include having a high pore volume, a high ratio of mesopore volume to micropore volume, and a sufficiently high acidity. The ability to allow supported amine sorbents to retain additional CO2 sorption capacity is unexpected. Additionally, the relationship between having sufficiently high acidity and providing improved sorption capacity for a supported amine material is unexpected.

Classes IPC  ?

• B01J 20/26 - Composés macromoléculaires synthétiques
• B01J 20/32 - Imprégnation ou revêtement

Abrégé

222 sorption capacity is unexpected. Additionally, the relationship between having sufficiently high acidity and providing improved sorption capacity for a supported amine material is unexpected.

Classes IPC  ?

• B01J 20/08 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance inorganique contenant des oxydes ou des hydroxydes des métaux non prévus dans le groupe contenant de l'oxyde ou de l'hydroxyde d'aluminiumCompositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance inorganique contenant des oxydes ou des hydroxydes des métaux non prévus dans le groupe contenant de la bauxite
• B01J 20/10 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance inorganique contenant de la silice ou un silicate
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques
• B01J 20/32 - Imprégnation ou revêtement
• B01D 53/02 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse
• B01D 53/62 - Oxydes de carbone

Abrégé

222 sorption capacity is unexpected. Conventionally, even when high pore volume support materials are used to support an amine sorbent, only a limited amount of the amine sorbent can be supported on the support material before substantial losses of sorbent capacity occur relative to the amount of amine sorbent.

Classes IPC  ?

• B01J 20/12 - Argiles d'origine naturelle ou terres décolorantes
• B01D 53/02 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse
• B01D 53/62 - Oxydes de carbone
• B01J 20/18 - Tamis moléculaires zéolitiques synthétiques
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques
• B01J 20/32 - Imprégnation ou revêtement

Abrégé

Monolith structures coated with porous solids are provided that can serve as structural materials for amine sorbents, such as polyamine sorbents. By using monolith structures that are coated with suitable porous solids, the sorption capacity of an amine sorbent material that is deposited on the monolith coated with the porous solid can be substantially maintained as the loading density of the amine is increased. This can allow for higher productivity sorption systems by allowing higher concentrations of amine to be effectively used while still substantially maintaining the favorable sorption characteristics of the amine sorbent.

Classes IPC  ?

• B01J 20/12 - Argiles d'origine naturelle ou terres décolorantes
• B01D 53/02 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse
• B01D 53/62 - Oxydes de carbone
• B01J 20/18 - Tamis moléculaires zéolitiques synthétiques
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques
• B01J 20/32 - Imprégnation ou revêtement
• B01J 20/16 - Alumino-silicates
• B01J 20/08 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance inorganique contenant des oxydes ou des hydroxydes des métaux non prévus dans le groupe contenant de l'oxyde ou de l'hydroxyde d'aluminiumCompositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance inorganique contenant des oxydes ou des hydroxydes des métaux non prévus dans le groupe contenant de la bauxite
• B01J 20/10 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance inorganique contenant de la silice ou un silicate

Abrégé

222 sorption capacity for the resulting supported modified polyamine material.

Abrégé

Crystalline support materials are provided that can serve as supports for polyamines. The support materials have a combination of properties that unexpectedly allows supported polyamines to retain an increased or maximized amount of CO2 sorption capacity after incorporation of substantial amounts of the polyamine on the support material. This combination of properties can include having a high pore volume, a high ratio of mesopore volume to micropore volume, and a sufficiently high acidity. The ability to allow supported amine sorbents to retain additional CO2 sorption capacity is unexpected. Conventionally, even when high pore volume support materials are used to support an amine sorbent, only a limited amount of the amine sorbent can be supported on the support material before substantial losses of sorbent capacity occur relative to the amount of amine sorbent.

Classes IPC  ?

• B01J 20/26 - Composés macromoléculaires synthétiques
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques

Abrégé

Monolith structures coated with porous solids are provided that can serve as structural materials for amine sorbents, such as polyamine sorbents. By using monolith structures that are coated with suitable porous solids, the sorption capacity of an amine sorbent material that is deposited on the monolith coated with the porous solid can be substantially maintained as the loading density of the amine is increased. This can allow for higher productivity sorption systems by allowing higher concentrations of amine to be effectively used while still substantially maintaining the favorable sorption characteristics of the amine sorbent.

Classes IPC  ?

• B01J 20/32 - Imprégnation ou revêtement
• B01J 20/26 - Composés macromoléculaires synthétiques

Abrégé

Propylene-based elastomer compositions that include a blend of a majority polymer fraction having a higher Mw and a minority polymer fraction having a lower Mw, methods of making same, and hot melt adhesives including such compositions. The polymer blend compositions can include: a major polymer fraction having a Mw of about 100,000 to about 300,000 and a melt flow rate of about 0.1 g/10 min to about 70.0 g/10 min, according to ASTM D1238; and a minor polymer fraction having a Mw of about 5,000 to about 60,000 and a Brookfield viscosity of about 500 cP to about 50,000 cP, according to ASTM D-3236 (190° C.), wherein an amount of the at least one other polyolefin comonomer in the minor polymer fraction is at least 7 wt % less than an amount of the at least one other polyolefin comonomer in the major polymer fraction.

Classes IPC  ?

• C08L 23/16 - Copolymères de l’éthylène et du propylène ou de l’éthylène, du propylène et de diène
• C09J 7/32 - Adhésifs sous forme de films ou de pellicules caractérisés par la composition de l’adhésif activés au contact de l’eau, p. ex. pour papier gommé
• C09J 123/16 - Copolymères éthylène-propène ou éthylène-propène-diène

Abrégé

Compositions are provided that include at least a portion of an isoparaffinic blend component, an iso-olefinic blend component, or a combination thereof, along with a method for making such a blend component. The highly isoparaffinic and/or iso-olefinic nature of the blend component can allow a blend component to be used in combination with both conventional/mineral fractions as well as non-traditional feeds to form fuel fractions and/or fuel blending component fractions. Examples of fuels that can be formed by making a blend that includes an isoparaffinic and/or iso-olefinic blend component include diesel fuels, marine gas oils, and various types of marine fuel oils, such as very low sulfur fuel oils.

Classes IPC  ?

• C10L 1/08 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures pour allumage par compression

Abrégé

Jet boiling range compositions are provided that include at least a portion of an isoparaffinic blend component, along with a method for making such a blend component. The highly isoparaffinic nature of the blend component can allow the isoparaffinic blend component to be used in combination with both conventional/mineral jet fuel boiling range fractions as well as non-traditional feeds (such as Fischer-Tropsch fractions) to form jet fuel fractions and/or jet fuel blending component fractions.

Classes IPC  ?

• C10L 1/08 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures pour allumage par compression

Abrégé

Palladium-based catalyst systems are provided for reforming of hydrocarbons, along with methods for using such catalyst systems. The catalyst systems can be deposited or otherwise coated on a surface or structure, such as a monolith, to achieve improved activity and/or structural stability. It has been discovered that loss of catalytic activity for reforming over time can be reduced or minimized for palladium-based catalyst system by operating the reactor/performing a reaction cycle so that the portion of the reaction environment containing the palladium-based catalyst system is not exposed to oxidizing conditions at temperatures between 600° C. and 900° C. Optionally, the reactor can also be operated/the reaction cycle can also be designed so that during a reforming cycle, the peak temperature in the portion of the reaction environment containing the palladium-based catalyst system is 1300° C. or less.

Classes IPC  ?

• B01J 35/00 - Catalyseurs caractérisés par leur forme ou leurs propriétés physiques, en général
• B01J 21/04 - Alumine
• B01J 23/44 - Palladium
• B01J 23/46 - Ruthénium, rhodium, osmium ou iridium
• B01J 23/755 - Nickel
• B01J 23/96 - Régénération ou réactivation de catalyseurs contenant des métaux, oxydes ou hydroxydes des métaux nobles
• B01J 35/57 - Nids d’abeilles
• B01J 37/00 - Procédés de préparation des catalyseurs, en généralProcédés d'activation des catalyseurs, en général
• B01J 38/12 - Traitement avec un gaz contenant de l'oxygène libre
• C01B 3/40 - Production d'hydrogène ou de mélanges gazeux contenant de l'hydrogène par réaction de composés organiques gazeux ou liquides avec des agents gazéifiants, p. ex. de l'eau, du gaz carbonique, de l'air par réaction d'hydrocarbures avec des agents gazéifiants avec des catalyseurs caractérisée par le catalyseur

Abrégé

This disclosure relates to EMM-41 materials, methods for making it, and processes for its use. This disclosure also relates to the structure directing agents used in the methods for making the EMM-41 material as well as the synthesis method used to prepare such structure directing agents.

Classes IPC  ?

• B01J 20/18 - Tamis moléculaires zéolitiques synthétiques
• B01D 53/02 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques
• B01J 20/30 - Procédés de préparation, de régénération ou de réactivation
• C01B 39/46 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie
• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique
• C07D 207/06 - Composés hétérocycliques contenant des cycles à cinq chaînons, non condensés avec d'autres cycles, ne comportant qu'un atome d'azote comme unique hétéro-atome du cycle avec uniquement des atomes d'hydrogène ou de carbone liés directement à l'atome d'azote du cycle ne comportant pas de liaison double entre chaînons cycliques ou entre chaînons cycliques et chaînons non cycliques avec des radicaux contenant uniquement des atomes d'hydrogène et de carbone, liés aux atomes de carbone du cycle
• C10G 25/03 - Raffinage des huiles d'hydrocarbures, en l'absence d'hydrogène, au moyen d'absorbants ou d'adsorbants solides avec échangeur d'ions avec des alumino-silicates cristallins, p. ex. avec des tamis moléculaires

Abrégé

Compositions are provided that include at least a portion of an isoparaffinic blend component, an iso-olefinic blend component, or a combination thereof, along with a method for making such a blend component. The highly isoparaffinic and/or iso-olefinic nature of the blend component can allow a blend component to be used in combination with both conventional/mineral fractions as well as non-traditional feeds to form fuel fractions and/or fuel blending component fractions. Examples of fuels that can be formed by making a blend that includes an isoparaffinic and/or iso-olefinic blend component include diesel fuels, marine gas oils, and various types of marine fuel oils, such as very low sulfur fuel oils.

Classes IPC  ?

• C10L 1/04 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures

Abrégé

Jet boiling range compositions are provided that include at least a portion of an isoparaffinic blend component, along with a method for making such a blend component. The highly isoparaffinic nature of the blend component can allow the isoparaffinic blend component to be used in combination with both conventional/mineral jet fuel boiling range fractions as well as non-traditional feeds (such as Fischer-Tropsch fractions) to form jet fuel fractions and/or jet fuel blending component fractions.

Classes IPC  ?

• C10L 1/04 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures
• C10L 1/16 - Hydrocarbures

Abrégé

This disclosure relates to EMM-41 materials, methods for making it, and processes for its use. This disclosure also relates to the structure directing agents used in the methods for making the EMM-41 material as well as the synthesis method used to prepare such structure directing agents.

Classes IPC  ?

• B01J 20/18 - Tamis moléculaires zéolitiques synthétiques
• B01D 53/02 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques
• B01J 20/30 - Procédés de préparation, de régénération ou de réactivation
• C01B 39/46 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie
• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique
• C07D 207/06 - Composés hétérocycliques contenant des cycles à cinq chaînons, non condensés avec d'autres cycles, ne comportant qu'un atome d'azote comme unique hétéro-atome du cycle avec uniquement des atomes d'hydrogène ou de carbone liés directement à l'atome d'azote du cycle ne comportant pas de liaison double entre chaînons cycliques ou entre chaînons cycliques et chaînons non cycliques avec des radicaux contenant uniquement des atomes d'hydrogène et de carbone, liés aux atomes de carbone du cycle
• C10G 25/03 - Raffinage des huiles d'hydrocarbures, en l'absence d'hydrogène, au moyen d'absorbants ou d'adsorbants solides avec échangeur d'ions avec des alumino-silicates cristallins, p. ex. avec des tamis moléculaires

Abrégé

An embodiment of the present disclosure provides an isolated nucleic acid molecule comprising a sequence encoding a protein having a PhaP1 domain and a HlyA domain, wherein the HlyA domain differs from the wild-type HlyA domain of E. coli (SEQ ID NO.: 1) An embodiment of the present disclosure provides an isolated nucleic acid molecule comprising a sequence encoding a protein having a PhaP1 domain and a HlyA domain, wherein the HlyA domain differs from the wild-type HlyA domain of E. coli (SEQ ID NO.: 1) SEQ ID NO. 1: LAYGSQGDLNPLINEISKIISAAGSFDVKEERTAAS LLQLSGNASDFSYGRNSITLTTSA in at least the wild-type amino acid residue S (serine) at position 25 (underlined above) is replaced with the amino acid residue N (asparagine).

Classes IPC  ?

• C12P 7/625 - Polyesters d'acides hydroxycarboxyliques
• C07K 14/195 - Peptides ayant plus de 20 amino-acidesGastrinesSomatostatinesMélanotropinesLeurs dérivés provenant de bactéries
• C07K 14/245 - Escherichia (G)
• C12N 15/70 - Vecteurs ou systèmes d'expression spécialement adaptés à E. coli

Abrégé

Disclosed embodiments may include a material having a composition including a mesophase pitch material between approximately 5.0% to 95.0% and having a viscosity of between approximately 0.01 to 102 Pascal seconds (Pa·s) in a temperature range of between approximately Ts

Classes IPC  ?

• H01M 4/583 - Matériau carboné, p. ex. composés au graphite d'intercalation ou CFx
• H01M 4/62 - Emploi de substances spécifiées inactives comme ingrédients pour les masses actives, p. ex. liants, charges
• H01M 10/0525 - Batteries du type "rocking chair" ou "fauteuil à bascule", p. ex. batteries à insertion ou intercalation de lithium dans les deux électrodesBatteries à l'ion lithium

Abrégé

Disclosed embodiments may include a material having a composition including a mesophase pitch material between approximately 5.0% to 95.0% and having a viscosity of between approximately 0.01 to 102s ≤ 475 oss ≥ 150 oC. At least a portion of the mesophase pitch material may be aligned by a magnetic field having a strength of approximately 0.25 to 6.0 Tesla. The portion of the mesophase pitch material may have an average molecular spacing of between approximately 3.4 to 3.7 angstroms, and an average molecular size of between approximately 1 to 3 nanometers (nm).

Classes IPC  ?

• C09K 19/02 - Substances formant des cristaux liquides caractérisées par les propriétés optiques, électriques ou physiques des constituants, en général
• C09K 19/04 - Substances formant des cristaux liquides caractérisées par la structure chimique des constituants formant des cristaux liquides
• D01F 9/145 - Filaments de carboneAppareils spécialement adaptés à leur fabrication par décomposition de filaments organiques à partir de brai ou de résidus de distillation
• D01F 9/32 - Appareils à cet effet
• G02F 1/1337 - Orientation des molécules des cristaux liquides induite par les caractéristiques de surface, p. ex. par des couches d'alignement
• C01B 32/15 - Matières carbonées nanométriques
• C10C 3/02 - Traitement du brai, de l'asphalte, du bitume par des moyens chimiques

Abrégé

Asphalt compositions are provided that correspond to blends of lubricating oil base stocks with deasphalter residue. It has unexpectedly been found that lubricating oil base stock can be blended with deasphalter residue to form asphalts that can satisfy the specification for various types of paving and/or roofing asphalts. As a result, lubricating oils can be used as a blend stock for uplift of deasphalter residue to asphalt while reducing, minimizing, or even eliminating the need to blend the deasphalter residue with a conventional vacuum distillation bottoms fraction.

Classes IPC  ?

• C08L 95/00 - Compositions contenant des matières bitumeuses, p. ex. asphalte, goudron ou brai
• C08L 91/00 - Compositions contenant des huiles, graisses ou ciresCompositions contenant leurs dérivés
• C10G 53/06 - Traitement des huiles d'hydrocarbures, en l'absence d'hydrogène, par plusieurs procédés de raffinage uniquement par plusieurs étapes en série comprenant au moins une étape d'extraction ne comprenant que des étapes d'extraction, p. ex. désasphaltage par un solvant suivi d'une extraction des composés aromatiques

Abrégé

Processes comprising: heat treating a heavy hydrocarbon feedstock in a heat treatment unit to produce a first effluent comprising a heat treated product; at least partially removing a mixture of gas and distillate from the first effluent in a first separation unit to produce a second effluent comprising a separation bottom product; deasphalting the second effluent in a second separation unit in the presence of a first solvent to produce: a soluble product fraction comprising a first portion of the first solvent, a deasphalted oil (DAO) product, and a first pitch product; an insoluble product fraction comprising a second portion of the first solvent and a portion of the first pitch product; and at least partially removing the second portion of the first solvent from the first pitch product in a third separation unit to produce a purified pitch product.

Classes IPC  ?

• C10C 3/08 - Traitement du brai, de l'asphalte, du bitume par extraction sélective
• C10C 3/00 - Traitement du brai, de l'asphalte, du bitume
• C10G 21/00 - Raffinage des huiles d'hydrocarbures, en l'absence d'hydrogène, par extraction au moyen de solvants sélectifs

Abrégé

A method involves propagating hydraulic fractures in a reservoir. Such method includes creating a low pressure region in an attractor well. The attractor well is proximate to an area in which hydraulic fractures are desired. The method also includes initiating a hydraulic fracturing operation at a treatment well. The hydraulic fracturing operation is initiated so that a fracture network created by the hydraulic fracturing operation is drawn to propagate toward the low pressure region of the attractor well.

Classes IPC  ?

• E21B 43/26 - Procédés pour activer la production par formation de crevasses ou de fractures
• E21B 43/30 - Disposition particulière des puits, p. ex. disposition rendant optimum l'espacement des puits

Abrégé

Rubber blends may comprise at least one rubber compound, and at least one wax mixed with the at least one rubber compound, and wherein the at least one wax comprises an unsaturated wax. Suitable unsaturated waxes may include, but are not limited to C18+ linear alpha olefins (LAOs), LAO dimers formed from C18+ LAOs and having an internal olefin, or any combination thereof. The C18+ LAOs may be C20-C24 LAOs or C24+ LAOs. The rubber blends may be used in forming various rubber articles and in forming at least a portion of a tire, such as a tire sidewall containing a vulcanized rubber blend.

Classes IPC  ?

• C08L 9/00 - Compositions contenant des homopolymères ou des copolymères d'hydrocarbures à diènes conjugués
• B60C 1/00 - Pneumatiques caractérisés par la composition chimique, la disposition ou le mélange physique de la composition
• C08L 7/00 - Compositions contenant du caoutchouc naturel

Abrégé

222222-containing gas to produce a regenerated and reduced catalyst.

Classes IPC  ?

• B01J 21/04 - Alumine
• B01J 21/10 - MagnésiumSes oxydes ou hydroxydes
• B01J 23/14 - Catalyseurs contenant des métaux, oxydes ou hydroxydes métalliques non prévus dans le groupe du germanium, de l'étain ou du plomb
• B01J 23/42 - Platine
• B01J 38/02 - Traitement thermique
• B01J 38/06 - Traitement avec un gaz ou une vapeurTraitement avec des liquides vaporisables au contact du catalyseur épuisé avec de la vapeur d'eau
• B01J 38/10 - Traitement avec un gaz ou une vapeurTraitement avec des liquides vaporisables au contact du catalyseur épuisé avec de l'hydrogène élémentaire
• B01J 38/14 - Traitement avec un gaz contenant de l'oxygène libre en réglant la teneur en oxygène dans le gaz d'oxydation
• C07C 5/32 - Préparation d'hydrocarbures à partir d'hydrocarbures contenant le même nombre d'atomes de carbone par déshydrogénation avec formation d'hydrogène libre

Abrégé

This disclosure relates to the use of 1-methyl-6,7-dihydro-5H-cyclopenta[b]pyridine-1-ium cation as structure directing agent (SDA) for the preparation of zeolites. This disclosure also relates to compositions of matter, designated as EMM-64 and EMM-65, obtainably by using this SDA, as well as a method of making the same and uses thereof. This disclosure further relates to a method of making an aluminosilicate molecular sieve of RTH framework type using said SDA, aluminosilicate molecular sieves of RTH framework type obtainable by said method, and uses thereof.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique
• B01J 29/70 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes de types caractérisés par leur structure spécifique non prévus dans les groupes
• B01J 29/86 - BorosilicatesAluminoborosilicates
• B01J 37/00 - Procédés de préparation des catalyseurs, en généralProcédés d'activation des catalyseurs, en général
• B01J 37/03 - PrécipitationCo-précipitation
• B01J 37/04 - Mélange
• B01J 37/10 - Traitement thermique en présence d'eau, p. ex. de vapeur d'eau
• C01B 39/12 - Préparation de zéolites isomorphes caractérisée par les mesures prises pour le remplacement des atomes d'aluminium ou de silicium dans la charpente du réseau par des atomes d'autres éléments les atomes de remplacement étant des atomes de bore
• C07D 221/04 - Systèmes cycliques condensés en ortho ou en péri

Abrégé

A method involves performing an enhanced oil recovery (EOR) operation. The method includes injecting a gas stream into a well via a first channel. The method also includes injecting enhanced oil recovery chemicals (EROCs) into the well via a second channel. The second channel is different from the first channel. An end of the first channel and an end of the second channel are positioned to facilitate static mixing of the gas stream with the EROCs to form an enriched gas stream in a subsurface region. The enriched gas stream facilitates the EOR operation.

Classes IPC  ?

• E21B 43/16 - Procédés de récupération assistée pour l'extraction d'hydrocarbures
• E21B 43/25 - Procédés pour activer la production

Abrégé

A jet boiling range composition is provided with an unexpected distribution of carbon chain lengths for the hydrocarbons and paraffins in the composition. The hydrocarbon composition corresponds to a jet boiling range composition that includes 40 wt % or more of hydrocarbons and/or paraffins that have carbon chain lengths of 17 carbons or 18 carbons. Additionally or alternately, the hydrocarbon composition can contain 45 wt % or less of C14-C17 hydrocarbons and/or paraffins. This unexpected distribution of carbon chain lengths in a jet boiling range composition can be achieved for a composition that has a freeze point of −40° C. or lower and a flash point of 38° C. or higher. Optionally, the jet boiling range composition can also have a T10 distillation point of 205° C. or less (such as down to 150° C.) and a final boiling point of 300° C. or less

Classes IPC  ?

• C10L 1/08 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures pour allumage par compression
• C10G 69/02 - Traitement des huiles d'hydrocarbures par au moins un procédé d'hydrotraitement et au moins un autre procédé de conversion uniquement par plusieurs étapes en série

Abrégé

Molecular sieves, designated as EMM-73, are provide. The molecular sieves are characterized by a unique powder XRD pattern. Both as-synthesized and calcined forms of the EMM-73 molecular sieves are provided. Methods of making the EMM-73 molecular sieves, as well as methods of using the EMM-73 molecular sieves, are also provided.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique
• B01J 29/70 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes de types caractérisés par leur structure spécifique non prévus dans les groupes
• B01J 37/00 - Procédés de préparation des catalyseurs, en généralProcédés d'activation des catalyseurs, en général
• B01J 37/03 - PrécipitationCo-précipitation
• B01J 37/04 - Mélange
• B01J 37/08 - Traitement thermique
• B01J 37/30 - Échange d'ions
• C01B 39/02 - Zéolites aluminosilicates cristallinesLeurs composés isomorphesLeur préparation directeLeur préparation à partir d'un mélange réactionnel contenant une zéolite cristalline d'un autre type, ou à partir de réactants préformésLeur post-traitement
• C01B 39/12 - Préparation de zéolites isomorphes caractérisée par les mesures prises pour le remplacement des atomes d'aluminium ou de silicium dans la charpente du réseau par des atomes d'autres éléments les atomes de remplacement étant des atomes de bore

Abrégé

Methods are provided for upgrading of pyrolysis carbon in order to allow for conversion of the pyrolysis carbon into higher value products. Instead of attempting to convert methane into a high value carbon product (such as carbon nanotubes) and H2 in a single reaction step, pyrolysis conditions can be used to form H2 and pyrolysis carbon. The pyrolysis carbon can then be treated in order to convert the pyrolysis carbon (H to C atomic ratio of less than 0.20) into a product with a higher hydrogen content (H to C atomic ratio of 0.25-0.9 or 2.0-7.0 wt % H). The treatment can correspond to exposing the pyrolysis carbon with hydrogen in the presence of a catalyst, exposing the pyrolysis carbon to conditions for alkylation, or a sequential combination thereof. This can convert the pyrolysis carbon into heavy hydrocarbon products that are resin-like solids at room temperature.

Classes IPC  ?

• C10G 1/08 - Production de mélanges liquides d'hydrocarbures à partir de schiste bitumineux, de sable pétrolifère ou de matières carbonées solides non fusibles ou similaires, p. ex. bois, charbon par hydrogénation destructive avec catalyseurs mobiles
• C01B 3/24 - Production d'hydrogène ou de mélanges gazeux contenant de l'hydrogène par décomposition de composés organiques gazeux ou liquides d'hydrocarbures

Abrégé

An amine-modified metal-organic framework composition is provided that has beneficial properties for performing direct air capture. The composition corresponds to a mixed-metal organic framework that includes 4,4'-dioxidobiphenyl-3,3'-dicarboxylate (dobpdc) as the linker. The mixed metals can correspond to two or more metals. In some aspects, the mixed-metal organic framework corresponds to M1xxM2(2-x)(2-x) (dobpdc). In various aspects, the mixed-metal organic framework is appended with N,N' -diethylethylenediamine (e-2-e).

Classes IPC  ?

• B01J 20/22 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance organique
• B01D 53/02 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques
• B01J 20/32 - Imprégnation ou revêtement
• B01J 20/34 - Régénération ou réactivation

Abrégé

Composite powders may be formed by blending silicon particles with petroleum pitch under grinding conditions. The composite powders may comprise up to about 50 wt.% silicon particles, based on total mass of the composite powder, and about 15 wt.% to about 95 wt.% petroleum pitch, based on total mass of the composite powder, and, optionally, up to 80 wt.% graphite particles. The silicon particles are dispersed in a matrix comprising the petroleum pitch and the petroleum pitch comprises a plurality of pitch particles. The composite powders may be subsequently converted to a carbon matrix comprising amorphous carbon by heating the petroleum pitch at a temperature of about 700°C to about 1800°C in an environment comprising about 0.1 mol% oxygen or below.

Classes IPC  ?

• C01B 32/205 - Préparation
• H01M 4/13 - Électrodes pour accumulateurs à électrolyte non aqueux, p. ex. pour accumulateurs au lithiumLeurs procédés de fabrication
• H01M 4/36 - Emploi de substances spécifiées comme matériaux actifs, masses actives, liquides actifs
• H01M 4/38 - Emploi de substances spécifiées comme matériaux actifs, masses actives, liquides actifs d'éléments simples ou d'alliages
• H01M 4/587 - Matériau carboné, p. ex. composés au graphite d'intercalation ou CFx pour insérer ou intercaler des métaux légers

Abrégé

An amine-modified metal-organic framework composition is provided that has beneficial properties for performing direct air capture. The composition corresponds to a mixed-metal organic framework that includes 4,4′-dioxidobiphenyl-3,3′-dicarboxylate (dobpdc) as the linker. The mixed metals can correspond to two or more metals. In some aspects, the mixed-metal organic framework corresponds to M1xM2(2-x) (dobpdc). In various aspects, the mixed-metal organic framework is appended with N,N′-diethylethylenediamine (e-2-e).

Classes IPC  ?

• B01J 20/22 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance organique
• B01D 53/04 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse avec adsorbants fixes

Abrégé

Pitch particles may be produced by a grinding process, in which pitch fines may be recovered and recycled to a grinding apparatus as a pitch melt. Such methods may comprise: providing a petroleum pitch having a first softening temperature; grinding the petroleum pitch in a grinding apparatus below the first softening temperature to produce a plurality of pitch particles and a plurality of pitch fines; separating the pitch particles from the pitch fines; heating the pitch fines at a temperature above the first softening temperature to produce a pitch melt; and combining the pitch melt with the petroleum pitch in the grinding apparatus. The pitch melt hardens in the grinding apparatus and is reground. The pitch particles may be further stabilized by heating at a treatment temperature below the first softening temperature in an environment comprising about 1 mol% to about 20 mol% oxygen to form stabilized pitch particles.

Classes IPC  ?

• C10G 31/06 - Raffinage des huiles d'hydrocarbures, en l'absence d'hydrogène, par des méthodes non prévues ailleurs par chauffage, refroidissement ou traitement par la pression
• C10C 3/00 - Traitement du brai, de l'asphalte, du bitume

Abrégé

Composite powders for electrode production may be formed by blending a graphitization catalyst or precursor thereof with petroleum pitch under grinding conditions. The composite powders may comprise about 0.1 wt.% to about 30 wt.% graphitization catalyst or a precursor thereof, based on total mass of the composite powder, and about 20 wt.% to about 99.9 wt.% petroleum pitch, based on total mass of the composite powder. The graphitization catalyst or the precursor thereof is dispersed in a matrix comprising the petroleum pitch, and the petroleum pitch comprises a plurality of pitch particles. The composite powders may be subsequently carbonized and then graphitized under conditions that may be less severe than un-catalyzed graphitization. The grinding conditions for forming the composite powders may include melt blending to form a continuous pitch matrix, wherein at least a portion of the graphitization catalyst or the precursor thereof may be dispersed within an interior of the pitch particles.

Classes IPC  ?

• C01B 32/205 - Préparation
• H01M 4/133 - Électrodes à base de matériau carboné, p. ex. composés d'intercalation du graphite ou CFx
• H01M 4/36 - Emploi de substances spécifiées comme matériaux actifs, masses actives, liquides actifs
• H01M 4/587 - Matériau carboné, p. ex. composés au graphite d'intercalation ou CFx pour insérer ou intercaler des métaux légers

Abrégé

A lubricant composition may be used as an engine oil. Such lubricant compositions may, for example, include: from about 25.0 mass % to about 99.8 mass % of an oil base stock, based on a total mass of the lubricant composition, the oil base stock including at least one bio-sourced basestock and at least one alkyl naphthalene; and wherein the lubricant composition includes about 0.05 mass % or less phosphorus, about 0.05 mass % or less sulfur, and about 0.5 mass % or less ash.

Classes IPC  ?

• C10M 169/04 - Mélanges de matériaux de base et d'additifs
• C10M 105/04 - Hydrocarbures définis aliphatiques
• C10M 105/06 - Hydrocarbures définis aromatiques
• C10M 129/50 - Acides carboxyliquesLeurs sels comportant des groupes carboxyle liés à un atome de carbone d'un cycle aromatique à six chaînons monocarboxyliques
• C10M 129/74 - Esters de composés polyhydroxylés
• C10M 133/12 - Amines, p. ex. polyalkylènepolyaminesAmines quaternaires comportant des groupes amine liés à un atome de carbone d'un cycle aromatique à six chaînons
• C10M 135/10 - Acides sulfoniques ou leurs dérivés
• C10M 141/08 - Compositions lubrifiantes caractérisées en ce que l'additif est un mélange d'au moins deux composés couverts par plus d'un des groupes principaux , chacun de ces composés étant un composé essentiel l'un d'eux, au moins, étant un composé organique contenant du soufre, du sélénium ou du tellure
• C10N 30/00 - Propriétés physiques ou chimiques particulières améliorées par l'additif caractérisant la composition lubrifiante, p. ex. additifs multifonctionnels
• C10N 30/04 - Propriétés détergentes ou dispersantes
• C10N 30/06 - OnctuositéRésistance du filmAnti-usureRésistance aux pressions extrêmes
• C10N 30/10 - Inhibition de l'oxydation, p. ex. anti-oxydants
• C10N 40/25 - Moteurs à combustion interne

Abrégé

The present disclosure relates to catalyst systems containing catalyst compounds and activators, and uses thereof. In some embodiments, a solution catalyst system includes a solution of aluminoxane comprising either anion modified alkylaluminoxane, and/or a cation modified alkylaluminoxane, the alkylaluminoxane composition having 0 wt% to about 2 wt% Al from non-coordinated trihydrocarbyl aluminum compound, based on total aluminum content of the alkylaluminoxane composition as determined by titration of the alkylaluminoxane composition with tetrahydrofuran. The catalyst system includes a compound represented by Formula (I).

Classes IPC  ?

• C08F 210/02 - Éthylène
• C08F 4/52 - MétauxHydrures métalliquesComposés organiques de métalLeur utilisation comme précurseurs de catalyseurs choisis parmi les métaux légers, le zinc, le cadmium, le mercure, le cuivre, l'argent, l'or, le bore, le gallium, l'indium, le thallium, les terres rares ou les actinides choisis parmi le bore, l'aluminium, le gallium, l'indium, le thallium ou les terres rares

Abrégé

The present disclosure relates to alumoxane compositions substantially or completely free of non-coordinated hydrocarbyl aluminum content, methods of forming such alumoxane compositions, catalyst systems having the alumoxane compositions, and methods of polymerizing olefins using catalyst systems having the alumoxane compositions. In some embodiments, a catalyst system includes at least one pre-catalyst compound. The catalyst system includes an unsupported or supported alumoxane. The alumoxane includes a monodentate siloxy ligand. In some embodiments, a method of making an alumoxane includes forming an ionic alkylalumoxane by reacting a supported or unsupported alkylalumoxane with a polydentate chelating agent to form a silane alkylaluminum complex. The method includes heating or aging the silane alkylaluminum complex to form a supported or unsupported alkylalumoxane comprising a monodentate ligand.

Classes IPC  ?

• C08F 10/00 - Homopolymères ou copolymères d'hydrocarbures aliphatiques non saturés contenant une seule liaison double carbone-carbone
• C08F 4/659 - Composant couvert par le groupe contenant une liaison métal de transition-carbone
• C08F 210/16 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP
• C08F 110/06 - Propène
• C08F 110/14 - Monomères contenant au moins cinq atomes de carbone
• C07F 5/06 - Composés de l'aluminium
• C08F 4/64 - Titane, zirconium, hafnium ou leurs composés
• C08F 4/6592 - Composant couvert par le groupe contenant une liaison métal de transition-carbone contenant au moins un cycle cyclopentadiényle, condensé ou non, p. ex. un cycle indényle ou fluorényle

Abrégé

The present disclosure relates to alumoxane compositions substantially or completely undetectable alkylaluminum content, methods of forming such alumoxane compositions, catalyst systems having the alumoxane compositions, and methods of polymerizing olefins using catalyst systems having the alumoxane compositions. In some embodiments, the present disclosure relates to unsupported or supported MAO compositions, methods of forming MAO, catalyst systems having MAO, and methods of polymerizing olefins using catalyst systems having MAO. In some embodiments, a method of making an unsupported or supported MAO with undetectable or low free trihydrocarbyl aluminum includes introducing an unsupported or supported MAO with an electron withdrawing compound to form an unsupported or supported MAO composition with undetectable or low free trihydrocarbyl aluminum.

Classes IPC  ?

• C08F 4/00 - Catalyseurs de polymérisation
• B01J 31/14 - Catalyseurs contenant des hydrures, des complexes de coordination ou des composés organiques contenant des composés organiques ou des hydrures métalliques contenant des composés organométalliques ou des hydrures métalliques d'aluminium ou de bore

Abrégé

A method for controlling the growth of a hydraulic fracture using a stress shadow generated during a hydraulic fracturing operation includes selecting a stage pair including a first stage and a second stage for which hydraulic fractures are to be generated via a hydraulic fracturing operation. The method also includes hydraulic fracturing the first stage to generate a corresponding first hydraulic fracture and controlling a magnitude of a stress shadow originating from the first hydraulic fracture by varying at least one parameter of the hydraulic fracturing operation, where the stress shadow is controlled so as to provide a second hydraulic fracture of a target fracture shape for the second stage. The method further includes hydraulic fracturing the second stage to generate the second hydraulic fracture with the target fracture shape.

Classes IPC  ?

• E21B 43/26 - Procédés pour activer la production par formation de crevasses ou de fractures

Abrégé

The present disclosure relates to a method of forming a composition including forming a polymer melt in a melt feeder. The melt feeder is coupled with an extruder. The method includes introducing the polymer melt from the melt feeder to the extruder at a first location of the extruder. The method includes extruding the polymer melt through the extruder via a plurality of intermeshing screws disposed within the extruder. The method includes introducing a coupling agent to the extruder at a second location of the extruder.

Classes IPC  ?

• B29B 7/48 - MélangeMalaxage continu, avec dispositifs mécaniques de mélange ou de malaxage avec dispositifs de mélange ou de malaxage mobiles rotatifs avec plus d'un arbre à dispositifs à engrènement, p. ex. à vis qui s'engrènent
• B29B 7/60 - Éléments constitutifs, détails ou accessoiresOpérations auxiliaires pour alimentation, p. ex. pièces de guidage pour la matière à traiter
• B29B 7/84 - Ventilation ou dégazage
• B29B 9/02 - Fabrication de granulés par division de matière préformée
• B29K 23/00 - Utilisation de polyalcènes comme matière de moulage
• B29K 105/00 - Présentation, forme ou état de la matière moulée
• B29L 30/00 - Pneumatiques, bandages pleins ou leurs parties constitutives
• B60C 1/00 - Pneumatiques caractérisés par la composition chimique, la disposition ou le mélange physique de la composition
• C08F 8/42 - Introduction d'atomes métalliques ou de groupes contenant des atomes métalliques

Abrégé

A system and method of extracting elements from an aqueous stream are described herein. The method includes designing a process to extract at least two elements from the aqueous product stream. The at least two elements have different commercial values. The process is optimized to minimize a cost of extracting the at least two elements and to maximize a value of extracting the at least two elements. The method further includes extracting the at least two elements according to the process.

Classes IPC  ?

• C22B 60/00 - Obtention des métaux ayant un nombre atomique de 87 ou plus, c.-à-d. métaux radioactifs
• B01D 61/02 - Osmose inverseHyperfiltration
• C22B 3/22 - Traitement ou purification de solutions, p. ex. de solutions obtenues par lixiviation par des procédés physiques, p. ex. par filtration, par des moyens magnétiques
• C22B 3/24 - Traitement ou purification de solutions, p. ex. de solutions obtenues par lixiviation par des procédés physiques, p. ex. par filtration, par des moyens magnétiques par adsorption sur des substances solides, p. ex. par extraction avec des résines solides
• C22B 26/12 - Obtention du lithium

Abrégé

Various zeolites may be produced under hydrothermal synthesis conditions in the presence of a silicon atom source and a bis-pyridinium compound having a structure represented by formula (I). Q is an optionally substituted C1-C10 hydrocarbyl group and two Q may join to form a carbocyclic ring; n is an integer ranging from 0 to 5; m is an integer ranging from 0 to 5; n+m is greater than or equal to 1; and A is a spacer group containing 2 to about 10 atoms. Various zeolites may be produced under hydrothermal synthesis conditions in the presence of a silicon atom source and a bis-pyridinium compound having a structure represented by formula (I). Q is an optionally substituted C1-C10 hydrocarbyl group and two Q may join to form a carbocyclic ring; n is an integer ranging from 0 to 5; m is an integer ranging from 0 to 5; n+m is greater than or equal to 1; and A is a spacer group containing 2 to about 10 atoms.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique

Abrégé

The present disclosure relates to the use of at least one cation selected from 1,2,3,5-tetramethylbenzimidazolium cation, 1,2,3,4,5-pentamethylbenzimidazolium cation, and 1,2,3,4,6-pentamethylbenzimidazolium cation as a structure directing agent for the preparation of molecular sieves. This disclosure also relates to a method of making molecular sieves using said structure directing agents, and to molecular sieves comprising said structure directing agents.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique

Abrégé

A system and method of extracting elements from an aqueous stream are described herein. The method includes designing a process to extract at least two elements from the aqueous product stream. The at least two elements have different commercial values. The process is optimized to minimize a cost of extracting the at least two elements and to maximize a value of extracting the at least two elements. The method further includes extracting the at least two elements according to the process.

Classes IPC  ?

• C02F 1/28 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par absorption ou adsorption
• B01D 61/02 - Osmose inverseHyperfiltration
• C02F 1/44 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par dialyse, osmose ou osmose inverse
• C02F 1/52 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par floculation ou précipitation d'impuretés en suspension
• B01D 61/10 - AccessoiresOpérations auxiliaires
• C02F 1/26 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par extraction
• C02F 1/42 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par échange d'ions
• C02F 1/66 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par neutralisationAjustage du pH
• C02F 101/10 - Composés inorganiques
• C02F 103/06 - Eau souterraine contaminée ou eau de lessivage
• C02F 103/10 - Nature de l'eau, des eaux résiduaires ou des eaux ou boues d'égout à traiter provenant de carrières ou d'activités minières
• C02F 103/36 - Nature de l'eau, des eaux résiduaires ou des eaux ou boues d'égout à traiter provenant de l'industrie chimique non prévue dans les groupes provenant de la fabrication de composés organiques

Abrégé

The present disclosure relates to catalysts, catalyst systems, polyethylene polymers, polymerization processes for making such polyethylene polymers, and films made therefrom. In some embodiments, a catalyst compound is represented by Formula (I) wherein M is Zr or Hf; R5and R6are each hydrogen; each of R1, R2, R3, and R411010 alkyl; one of (1) R7and R8, (2) R8and R9, or (3) R9and R10are joined to form a substituted or unsubstituted aromatic ring or saturated ring fused to the indenyl ring shown in Formula (I), and the remainder of R7, R8, R9, and R1034040 alpha-olefin to a catalyst system in a reactor, and forming a polyethylene composition.

Classes IPC  ?

• C08F 210/16 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP
• C08F 4/659 - Composant couvert par le groupe contenant une liaison métal de transition-carbone
• C07F 17/00 - Metallocènes
• B32B 27/00 - Produits stratifiés composés essentiellement de résine synthétique

Abrégé

The present disclosure relates to catalysts, catalyst systems, polyethylene polymers, polymerization processes for making such polyethylene polymers, and films made therefrom. In some embodiments, an unbridged catalyst compound is represented by Formula (II). M is a group 4 metal. Each of R1, R2, R3, R4, R7, R8, R9, R10, R11, R14, R15, R15, R16, R16, R17, R17, R18, R18', R19, R19, R20, R20, R21, R21, R22, and R22 is independently hydrogen, a substituted or unsubstituted hydrocarbyl, a substituted or unsubstituted heteroatom, or a substituted or unsubstituted heteroatom-containing group. Each X is independently a halide, a substituted or unsubstituted hydrocarbyl, a hydride, an amide, a substituted or unsubstituted alkoxide, a sulfide, a phosphide, or a combination thereof, or two of X are joined together to form a substituted or unsubstituted metallocycle ring, or two of X are joined to form a chelating ligand, a diene ligand, or an alkylidene.

Classes IPC  ?

• C08F 210/16 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP
• C08F 4/659 - Composant couvert par le groupe contenant une liaison métal de transition-carbone
• C07F 9/66 - Composés de l'arsenic
• B32B 27/00 - Produits stratifiés composés essentiellement de résine synthétique

Abrégé

The present disclosure relates to catalysts, polyethylene polymers, polymerization processes for making such polyethylene polymers, and films made therefrom. In some embodiments, a catalyst system includes a first catalyst compound. The first catalyst compound is represented by Formula (I). At least one of R4and R5, R5and R6, or R6and R7of Formula (I) are joined to form a first substituted or unsubstituted completely saturated ring fused to the indenyl ring and at least one of R11and R12, R12and R13, or R13and R14are joined to form a second substituted or unsubstituted completely saturated ring fused to the indenyl ring. The catalyst system further includes a second catalyst represented by Formula (III). At least one of R7and R8, R8and R9, or R9and R10 of Formula (III) are joined to form a substituted or unsubstituted completely saturated ring fused to the indenyl ring.

Classes IPC  ?

• C08F 210/16 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP
• C08F 4/659 - Composant couvert par le groupe contenant une liaison métal de transition-carbone
• B32B 27/32 - Produits stratifiés composés essentiellement de résine synthétique comprenant des polyoléfines
• C07F 9/66 - Composés de l'arsenic

Abrégé

32020 comonomer units. The polyethylene copolymer has a bimodal composition distribution, a density of 0.914 g/cm 3to 0.925 g/cm3, a melt index of 0.1 g/10min to 1 g/10min, a high load melt index (HLMI) of 21 g/10 min to 70 g/10 min, a melt index ratio (MIR) of 40 to 65, and a molecular weight distribution (MWD) of 4 to 7.

Classes IPC  ?

• C08F 210/16 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP
• C08F 210/14 - Monomères contenant au moins cinq atomes de carbone
• C08F 4/6592 - Composant couvert par le groupe contenant une liaison métal de transition-carbone contenant au moins un cycle cyclopentadiényle, condensé ou non, p. ex. un cycle indényle ou fluorényle

Abrégé

32020 comonomer units. The polyethylene copolymer has a bimodal composition distribution, a density of about 0.914 g/cm3to about 0.925 g/cm3, a melt index of about 0.1 g/10min to about 1 g/min, a high load melt index (HLMI) of about 1 or 12 g/10 min to about 30 g/10 min, a melt index ratio (MIR) of about 30 or 35 to about 60 or 65, and a molecular weight distribution (MWD) of about 3 or 4.5 to about 7 or 7.5. The copolymer may also exhibit a combination of bimodal composition distribution, such as broad orthogonal composition distribution (BOCD), and long chain branching (LCB).

Classes IPC  ?

• C08F 4/659 - Composant couvert par le groupe contenant une liaison métal de transition-carbone
• C08F 210/16 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP
• C08L 23/08 - Copolymères de l'éthylène

Abrégé

A method and system for seismic anomaly detection is disclosed. Hydrocarbon prospecting relies on accurate modeling of subsurface geologic structures and detecting fluid presence in the geologic structures. For example, a seismic survey is gathered and processed to create a mapping of the subsurface region. The processed data is then examined, such as by comparing pre- or partially-stacked seismic images, in order to identify subsurface structures that may contain hydrocarbons. Instead of relying on engineered image attributes, which may be unreliable and biased, to identify anomalous features, an unsupervised machine learning framework is used to learn the relationships among partially-stack images or among pre-stack images to detect the anomalous features, and in turn hydrocarbon presence.

Classes IPC  ?

• G01V 1/34 - Représentation des enregistrements sismiques
• G01V 1/30 - Analyse
• G06N 20/00 - Apprentissage automatique

Abrégé

A composition may include: a pitch composition having an MCR of greater than 30 wt.%, a softening point between about 30 °C to about 240 °C, and wherein the pitch composition is 100 wt.% soluble in toluene.

Classes IPC  ?

• C10G 21/00 - Raffinage des huiles d'hydrocarbures, en l'absence d'hydrogène, par extraction au moyen de solvants sélectifs
• C08L 95/00 - Compositions contenant des matières bitumeuses, p. ex. asphalte, goudron ou brai
• C10C 3/08 - Traitement du brai, de l'asphalte, du bitume par extraction sélective
• C10G 67/04 - Traitement des huiles d'hydrocarbures, uniquement par au moins un procédé d'hydrotraitement et au moins un procédé de raffinage en l'absence d'hydrogène uniquement par plusieurs étapes en série comprenant une extraction par solvant comme étape de raffinage en l'absence d'hydrogène
• C10C 3/00 - Traitement du brai, de l'asphalte, du bitume

Abrégé

This disclosure relates to catalysts, polyethylene polymers, polymerization processes for making such polyethylene polymers, and films made therefrom. In various embodiments, polymerization processes include dual catalyst polymerizations, such as those carried out by combining a base metallocene catalyst and trim metallocene catalyst, wherein the base catalyst may optionally be supported in a first catalyst mixture such as a solvent, and the trim catalyst can be added in varying ratios to the supported base catalyst. Polymerizations using the combinations of the base and trim catalysts such as those described herein can produce linear low density polyethylene copolymers having a moderate degree of long chain branching, which may exhibit improved processability in producing films. Further, films made from such polymers may exhibit improved properties such as superior shrink.

Classes IPC  ?

• C08F 210/16 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP
• B32B 27/32 - Produits stratifiés composés essentiellement de résine synthétique comprenant des polyoléfines
• C08F 4/659 - Composant couvert par le groupe contenant une liaison métal de transition-carbone
• C08J 5/18 - Fabrication de bandes ou de feuilles

Abrégé

Processes for making poly alpha-olefins (PAO) at high catalyst efficiency, good kinetics, and high conversions are provided. In at least one embodiment, the process includes feeding at least one catalyst to an oligomerization reactor; feeding at least one activator to the oligomerization reactor; feeding one or more linear alpha olefins to the oligomerization reactor and oligomerizing the one or more linear alpha olefins within the oligomerization reactor in the presence of the catalyst and the activator to produce a poly alpha-olefin (PAO). The catalyst and activator do not contact one another outside of the oligomerization reactor.

Classes IPC  ?

• C07C 2/34 - Complexes métal-hydrocarbure
• C07C 11/02 - Alcènes
• C08F 4/659 - Composant couvert par le groupe contenant une liaison métal de transition-carbone
• C08F 4/6592 - Composant couvert par le groupe contenant une liaison métal de transition-carbone contenant au moins un cycle cyclopentadiényle, condensé ou non, p. ex. un cycle indényle ou fluorényle
• C08F 10/14 - Monomères contenant au moins cinq atomes de carbone

Abrégé

Systems and methods are provided for synthesizing multi-ring disalicylate linkers. The systems and methods can allow for synthesis of disalicylate linkers while using a reduced or minimized amount of solvent (such as down to potentially having no separate solvent) in the reaction environment. The synthesis can be performed by starting with a compound such as 4,4′-biphenol as a starting reagent. The 4,4′-biphenol (and/or other alcohol-substituted biphenyl compound) can then be exposed in a reaction environment to pressurized CO2 in the presence of a base. The temperature and pressure in the reaction environment can be increased to achieve either supercritical conditions for the CO2 (based on a phase diagram for neat CO2) and/or sub-critical conditions that are substantially similar to supercritical conditions. This can allow for conversion of the 4,4′-biphenol (or other alcohol-substituted biphenyl compound) into a multi-ring disalicylate linker.

Classes IPC  ?

• C07C 51/295 - Préparation d'acides carboxyliques, de leurs sels, halogénures ou anhydrides par oxydation avec des bases inorganiques, p. ex. par fusion alcaline

Abrégé

Techniques described herein relate to a well completion including a liner extending into a reservoir. The liner includes a number of nozzles arranged along the liner and configured to open at different times to optimize stimulation of a well without decreasing well productivity. Each of a subset of the number of nozzles includes a nozzle insert including an acid-resistant material that delays an opening of the subset of number of nozzles during stimulation.

Classes IPC  ?

• E21B 43/27 - Procédés pour activer la production par formation de crevasses ou de fractures par emploi de produits chimiques érosifs, p. ex. d'acides
• E21B 41/00 - Matériel ou accessoires non couverts par les groupes

Abrégé

Provided is a biaxially oriented shrink film comprising a metallocene linear low density polyethylene having a density in the range of from 0.900 g/cm3to 0.940 g/cm322) in the range of from 0.1 g/10 min to 5.0 g/10 min, a melt index ratio (MIR) in the range of from 20 to 38, a molecular weight distribution (MWD) in the range of from 2.0 to 4.5, and a broad orthogonal comonomer distribution. In some embodiments, the shrink film provides adequate shrink force at a temperature less than 160°C.

Classes IPC  ?

• B32B 27/08 - Produits stratifiés composés essentiellement de résine synthétique comme seul composant ou composant principal d'une couche adjacente à une autre couche d'une substance spécifique d'une résine synthétique d'une sorte différente
• B32B 27/18 - Produits stratifiés composés essentiellement de résine synthétique caractérisée par l'emploi d'additifs particuliers
• B32B 27/32 - Produits stratifiés composés essentiellement de résine synthétique comprenant des polyoléfines
• C08J 5/18 - Fabrication de bandes ou de feuilles
• C08L 23/06 - Polyéthylène
• B65D 71/08 - Enveloppes rétractables par chauffage

Abrégé

Blending of polyvinylchloride (PVC) and other rigid polymers may be facilitated using lubricant compositions comprising linear alpha olefins (LAOs) or compounds derived from LAOs. PVC blending methods may comprise: combining PVC and a lubricant composition to form a mixture, and blending the mixture to form a lubricated PVC blend, in which the mixture contains an effective amount of the lubricant composition to provide a fusion temperature for the lubricated PVC blend of about 190° C. or below as determined by torque rheometry at 65 rpm. The lubricant composition may comprise one or more C18+ linear alpha olefins (LAOs) having a kinematic viscosity of about 4 cSt or less at 135° C., or one or more LAO dimers formed from the one or more C18+ LAOs, the one or more LAO dimers having an internal olefin and a kinematic viscosity of about 6 cSt or less at 135° C., or reduced LAO dimers.

Classes IPC  ?

• C08J 3/20 - Formation de mélanges de polymères avec des additifs, p. ex. coloration
• C08K 5/01 - Hydrocarbures
• C08L 27/06 - Homopolymères ou copolymères du chlorure de vinyle
• C08L 91/06 - Cires

Abrégé

Aluminosilicate zeolites, designated as EMM-68, characterized by a unique powder XRD pattern or unique connectivities, methods of making the same, and uses thereof.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique
• C01B 39/04 - Zéolites aluminosilicates cristallinesLeurs composés isomorphesLeur préparation directeLeur préparation à partir d'un mélange réactionnel contenant une zéolite cristalline d'un autre type, ou à partir de réactants préformésLeur post-traitement utilisant au moins un agent structurant organique, p. ex. un composé d'ammonium quaternaire ionique ou un composé aminé

Abrégé

Systems and methods are provided for integrated production of inorganic compounds from photosythetically-derived organic carbon. The photosynthetically-derived organic carbon can correspond to any convenient form of biomass and/or biologically formed products, such as amino acids. In some aspects, the biomass can include a combination of legumes and associated Rhizobia and/or ureolytic bacteria that can provide synergies for improved production of carbonates from the biomass

Classes IPC  ?

• C01B 32/60 - Préparation des carbonates ou des bicarbonates en général
• C12P 3/00 - Préparation d'éléments ou de composés inorganiques à l'exception du dioxyde de carbone

Abrégé

Catalysts and corresponding methods for oligomerization of olefins to distillate boiling range compounds are provided. The oligomerization can be performed in the presence of a catalyst including a 10-member ring or 1-D 12-member ring zeolitic framework material that contains both silica and alumina. The zeolitic framework material can have a low molar ratio of silica to alumina. The zeolitic framework material can be ion-exchanged to a small but substantial degree with alkaline earth metal cations, such as Mg, Ca, Sr, or Ba. The small but substantial amount of ion exchange can correspond to having a molar ratio of alkaline earth metal to aluminum of up to 0.2.

Classes IPC  ?

• C07C 2/12 - Procédés catalytiques avec des alumino-silicates cristallins, p. ex. avec des tamis moléculaires
• B01J 29/70 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes de types caractérisés par leur structure spécifique non prévus dans les groupes
• B01J 35/64 - Diamètre des pores
• B01J 37/30 - Échange d'ions

Abrégé

A lubricant composition may be of use in lubrication of an internal combustion engine. A method of utilizing such a lubricant composition may include: lubricating an internal combustion engine using a lubricant composition comprising: from about 30.0 mass % to about 99.8 mass % of an oil base stock, based on a total mass of the lubricant composition, the oil base stock comprising at least one polyol ester; and from 1.0 mass % to 30.0 mass % polyisobutylene, based on a total mass of the lubricant composition; and combusting a fuel in the internal combustion engine.

Classes IPC  ?

• C10M 111/04 - Compositions lubrifiantes caractérisées en ce que le matériau de base est un mélange d'au moins deux composés couverts par plus d'un des groupes principaux , chacun de ces composés étant un composé essentiel l'un d'eux, au moins, étant un composé organique macromoléculaire
• C10L 1/04 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures
• C10M 105/38 - Esters de composés polyhydroxylés
• C10M 107/08 - Polymères d'hydrocarburesPolymères d'hydrocarbures modifiés par oxydation contenant du butène
• C10M 129/10 - Composés hydroxylés comportant des groupes hydroxyle liés à un atome de carbone d'un cycle aromatique à six chaînons
• C10M 133/12 - Amines, p. ex. polyalkylènepolyaminesAmines quaternaires comportant des groupes amine liés à un atome de carbone d'un cycle aromatique à six chaînons
• C10M 141/06 - Compositions lubrifiantes caractérisées en ce que l'additif est un mélange d'au moins deux composés couverts par plus d'un des groupes principaux , chacun de ces composés étant un composé essentiel l'un d'eux, au moins, étant un composé organique contenant de l'azote
• C10M 169/04 - Mélanges de matériaux de base et d'additifs
• C10N 20/02 - ViscositéIndice de viscosité
• C10N 30/00 - Propriétés physiques ou chimiques particulières améliorées par l'additif caractérisant la composition lubrifiante, p. ex. additifs multifonctionnels
• C10N 30/02 - Point d'écoulementIndice de viscosité
• C10N 30/10 - Inhibition de l'oxydation, p. ex. anti-oxydants
• C10N 40/25 - Moteurs à combustion interne

Abrégé

An acoustic fluid monitoring system, as well as a method for monitoring fluid flow within a pipe using the acoustic fluid monitoring system, are provided herein. The system includes a first sensing probe and a second sensing probe that are acoustically coupled to the outer surface of a wall of a pipe through which a fluid is flowing. The first sensing probe operates at a first resonance frequency, and the second sensing probe operates at a second resonance frequency. The first sensing probe and the second sensing probe are configured to record a first acoustic signal and a second acoustic signal, respectively, corresponding to an acoustic wave propagating through the pipe wall. Characteristics of the first acoustic signal and the second acoustic signal, as well as the relationship between the first acoustic signal and the second acoustic signal, relate to one or more properties of the fluid flowing through the pipe.

Classes IPC  ?

• G01N 29/02 - Analyse de fluides
• G01F 1/66 - Mesure du débit volumétrique ou du débit massique d'un fluide ou d'un matériau solide fluent, dans laquelle le fluide passe à travers un compteur par un écoulement continu en mesurant la fréquence, le déphasage, le temps de propagation d'ondes électromagnétiques ou d'autres types d'ondes, p. ex. en utilisant des débitmètres à ultrasons
• G01F 1/74 - Dispositifs pour la mesure du débit d'un matériau fluide ou du débit d'un matériau solide fluent en suspension dans un autre fluide
• G01N 15/00 - Recherche de caractéristiques de particulesRecherche de la perméabilité, du volume des pores ou de l'aire superficielle effective de matériaux poreux
• G01N 15/02 - Recherche de la dimension ou de la distribution des dimensions des particules
• G01N 29/22 - Recherche ou analyse des matériaux par l'emploi d'ondes ultrasonores, sonores ou infrasonoresVisualisation de l'intérieur d'objets par transmission d'ondes ultrasonores ou sonores à travers l'objet Détails
• G01N 29/42 - Détection du signal de réponse par filtrage en fréquence
• G01N 29/44 - Traitement du signal de réponse détecté

Abrégé

Provided are methods of hydro-dealkylation of hydrocarbon feedstock to produce an intermediate hydrocarbon product having a boiling point at T10 of greater than about 500° F.+ by distillation method ASTM D7169 and a viscosity index greater than about 120 in accordance with ASTM D2270 where at least about 50 percent of the hydrocarbon feedstock is a SIMDIS of 400° F. The intermediate hydrocarbon product can be used to produce a base stock, a wax and/or paraffinic diesel.

Classes IPC  ?

• C10G 65/04 - Traitement des huiles d'hydrocarbures, uniquement par plusieurs procédés d'hydrotraitement uniquement par plusieurs étapes en série ne comprenant que des étapes de raffinage
• C10G 73/06 - Obtention des cires de pétrole à partir des huiles d'hydrocarburesDéparaffinage d'huiles d'hydrocarbures avec emploi de solvants
• C10G 73/36 - Obtention des cires de pétrole à partir d'autres compositions contenant de petites quantités d'huile, à partir de concentrats ou de résidusDéshuilage, resuage
• C10G 73/44 - Raffinage des cires de pétrole en présence d'hydrogène ou en présence de composés donneurs d'hydrogène

Abrégé

An artificial lift system and corresponding method for artificially lifting production fluids are described herein. The artificial lift system includes a well configured to receive a hollow sphere suspension. A pump coupled to the well is to pump the hollow sphere suspension into the well. A. downhole injection point in a. tubing of the well displaces the hollow sphere suspension between the tubing and an annulus of the well to lift the hollow sphere suspension with hydrocarbon fluids from the well.

Classes IPC  ?

• E21B 43/12 - Procédés ou appareils pour commander l'écoulement du fluide extrait vers ou dans les puits

Abrégé

A lubricant composition may be of use in lubrication of an internal combustion engine. A method of utilizing such a lubricant composition may include: lubricating an internal combustion engine using a lubricant composition comprising: from about 30.0 mass % to about 99.8 mass % of an oil base stock, based on a total mass of the lubricant composition, the oil base stock comprising at least one polyol ester; and from 1.0 mass % to 30.0 mass % polyisobutylene, based on a total mass of the lubricant composition; and combusting a fuel in the internal combustion engine.

Classes IPC  ?

• C10M 105/38 - Esters de composés polyhydroxylés
• C10M 143/06 - Compositions lubrifiantes caractérisées en ce que l'additif est un hydrocarbure macromoléculaire ou un tel hydrocarbure modifié par oxydation contenant du butène

Abrégé

Gear oil compositions including a first oil basestock and a second basestock. The first basestock includes a Group II bright stock having a kinematic viscosity (ASTM D445, 40°C) of from 250 mm2/s to 600 mm2/s, a kinematic viscosity (ASTM D445, 100°C) of from 20 mm2/s to 70 mm2/s, a viscosity index (ASTM D2270) of from 80 to 120, and a pour point (ASTM D97) of from -50°C to -20°C. The second basestock includes a polyalphaolefin (PAO) basestock having a kinematic viscosity (ASTM D445, 40°C) of from 500 mm2/s to 3500 mm2/s, a kinematic viscosity (ASTM D445, 100°C) of from 60 mm2/s to 300 mm2/s, a viscosity index (ASTM D2270) of from 150 to 250, and a pour point (ASTM D97) of from -50°C to -20°C.

Classes IPC  ?

• C10M 111/04 - Compositions lubrifiantes caractérisées en ce que le matériau de base est un mélange d'au moins deux composés couverts par plus d'un des groupes principaux , chacun de ces composés étant un composé essentiel l'un d'eux, au moins, étant un composé organique macromoléculaire
• C10M 171/02 - Valeurs particulières de la viscosité ou de l'indice de viscosité
• C10N 20/00 - Propriétés physiques particulières des constituants des compositions lubrifiantes
• C10N 20/02 - ViscositéIndice de viscosité
• C10N 30/10 - Inhibition de l'oxydation, p. ex. anti-oxydants
• C10N 40/04 - Bains d'huileBoîtes de vitessesTransmissions automatiquesMécanismes de traction

Abrégé

A method involves detecting parameters corresponding to a hydraulic connection between wells in a reservoir. Such method includes injecting carbonated water into a CO2 injection well. The method further includes identifying a presence of the carbonated water around a CO2 recipient well. The method also includes determining at least one parameter corresponding to the hydraulic connection between the CO2 injection well and the CO2 recipient well based on the presence of the carbonated water around the CO2 recipient well.

Classes IPC  ?

• E21B 49/08 - Prélèvement d'échantillons de fluides ou test des fluides dans les trous de forage ou dans les puits
• E21B 43/16 - Procédés de récupération assistée pour l'extraction d'hydrocarbures
• E21B 43/26 - Procédés pour activer la production par formation de crevasses ou de fractures
• E21B 43/30 - Disposition particulière des puits, p. ex. disposition rendant optimum l'espacement des puits

Abrégé

Venturi-type scrubbers may be utilized in conjunction with removing solids from and quenching a gas-phase reaction product. Methods may comprise: providing a reaction product comprising a hydrocarbon gas and solids; introducing the reaction product into a Venturi-type scrubber; introducing a scrubbing fluid into the Venturi-type scrubber, wherein the scrubbing fluid is at a lower temperature than the reaction product; producing from the Venturi-type scrubber a multi-phase product comprising a scrubbed reaction product and a spent scrubbing fluid, the scrubbed reaction product comprising the hydrocarbon gas and the spent scrubbing fluid comprising the scrubbing fluid and the solids; and separating the hydrocarbon gas from the multi-phase fluid. Systems may comprise a reactor; a Venturi-type scrubber having a first inlet fluidly connected to the reactor and a second inlet configured to receive a scrubbing fluid; and a separation tower configured to receive a multi-phase stream from the Venturi-type scrubber after solids removal.

Classes IPC  ?

• C07C 7/11 - Purification, séparation ou stabilisation d'hydrocarburesEmploi d'additifs par absorption, c.-à-d. purification ou séparation d'hydrocarbures gazeux à l'aide de liquides
• B01D 47/10 - Épurateurs à Venturi

Abrégé

Systems, methods, and compositions for biocatalyzed conversion of oleic acid to non-racemic (R)-10-hydroxystearic acid ((R)-10-HSA) are described herein. Some systems and methods may include mixing oleic acid, a buffer, and a surfactant to produce an emulsion. The emulsion may be mixed with recombinant enzyme produced by a transformed microorganism. The recombinant enzyme may biocatalytically convert oleic acid to (R)-10-HSA, which may be extracted from the emulsion via an organic solvent.

Classes IPC  ?

• C12P 7/18 - Polyols
• C12N 9/88 - Lyases (4.)

Abrégé

Gear oil compositions including a first oil basestock and a second basestock. The first basestock includes a Group II bright stock having a kinematic viscosity (ASTM D445, 40° C.) of from 250 mm2/s to 600 mm2/s, a kinematic viscosity (ASTM D445, 100° C.) of from 20 mm2/s to 70 mm2/s, a viscosity index (ASTM D2270) of from 80 to 120, and a pour point (ASTM D97) of from −50° C. to −20° C. The second basestock includes a polyalphaolefin (PAO) basestock having a kinematic viscosity (ASTM D445, 40° C.) of from 500 mm2/s to 3500 mm2/s, a kinematic viscosity (ASTM D445, 100° C.) of from 60 mm2/s to 300 mm2/s, a viscosity index (ASTM D2270) of from 150 to 250, and a pour point (ASTM D97) of from −50° C. to −20° C.

Classes IPC  ?

• C10M 169/04 - Mélanges de matériaux de base et d'additifs
• C10M 101/02 - Fractions de pétrole
• C10M 107/02 - Polymères d'hydrocarburesPolymères d'hydrocarbures modifiés par oxydation
• C10M 111/04 - Compositions lubrifiantes caractérisées en ce que le matériau de base est un mélange d'au moins deux composés couverts par plus d'un des groupes principaux , chacun de ces composés étant un composé essentiel l'un d'eux, au moins, étant un composé organique macromoléculaire
• C10M 127/06 - Hydrocarbures aromatiques alkylés
• C10M 129/72 - Esters d'acides polycarboxyliques
• C10M 129/74 - Esters de composés polyhydroxylés
• C10M 141/02 - Compositions lubrifiantes caractérisées en ce que l'additif est un mélange d'au moins deux composés couverts par plus d'un des groupes principaux , chacun de ces composés étant un composé essentiel l'un d'eux, au moins, étant un composé organique contenant de l'oxygène
• C10N 20/02 - ViscositéIndice de viscosité
• C10N 30/02 - Point d'écoulementIndice de viscosité
• C10N 30/04 - Propriétés détergentes ou dispersantes
• C10N 30/10 - Inhibition de l'oxydation, p. ex. anti-oxydants
• C10N 30/12 - Inhibition de la corrosion, p. ex. agents antirouille, agents anticorrosifs
• C10N 30/18 - Propriétés antimousse
• C10N 40/04 - Bains d'huileBoîtes de vitessesTransmissions automatiquesMécanismes de traction

Abrégé

Venturi-type scrubbers may be utilized in conjunction with removing solids from and quenching a gas-phase reaction product. Methods may comprise: providing a reaction product comprising a hydrocarbon gas and solids; introducing the reaction product into a Venturi-type scrubber; introducing a scrubbing fluid into the Venturi-type scrubber, wherein the scrubbing fluid is at a lower temperature than the reaction product; producing from the Venturi-type scrubber a multi-phase product comprising a scrubbed reaction product and a spent scrubbing fluid, the scrubbed reaction product comprising the hydrocarbon gas and the spent scrubbing fluid comprising the scrubbing fluid and the solids; and separating the hydrocarbon gas from the multi-phase fluid. Systems may comprise a reactor; a Venturi -type scrubber having a first inlet fluidly connected to the reactor and a second inlet configured to receive a scrubbing fluid; and a separation tower configured to receive a multi-phase stream from the Venturi-type scrubber after solids removal.

Classes IPC  ?

• B01D 47/10 - Épurateurs à Venturi
• B01D 53/72 - Composés organiques non prévus dans les groupes , p. ex. hydrocarbures
• B01D 53/34 - Épuration chimique ou biologique des gaz résiduaires

Abrégé

Processes and systems for stabilizing the operation of a steam cracker primary fractionator. In some embodiments, the process can include (I) feeding a first steam cracker effluent into a steam cracker primary fractionator. The process can also include (II) feeding a make-up liquid stream into the steam cracker primary fractionator. The process can also include (III) recovering a steam cracker gas oil (“SCGO”) side stream from the steam cracker primary fractionator. The process can also include (IV) recovering a steam cracker tar (“SCT”) stream from a location at and/or in the vicinity of a bottom of the primary fractionator. The make-up liquid stream can include a first hydrocarbon portion and a second hydrocarbon portion. The first hydrocarbon portion can be distributed into the SCGO side stream. The second hydrocarbon portion can be distributed into the SCT stream.

Classes IPC  ?

• C10G 9/36 - Craquage thermique non catalytique, en l'absence d'hydrogène, des huiles d'hydrocarbures par contact direct avec des fluides inertes préchauffés, p. ex. avec des métaux ou sels fondus avec des gaz ou vapeurs chauds
• B01D 3/14 - Distillation fractionnée

Abrégé

Methods for polymerizing polyethylene in a tubular reactor may comprise: compressing ethylene monomer to a. pressure from about 2900 bar to about 3150 bar; introducing the compressed ethylene monomer and a modifier into the tubular reactor having two or more reaction zones, wherein each of the two or more reaction zones independently has a peak zonal temperature within a range of about 180° C. to about 300° C.; and producing a polyethylene composition having a density of about 0.9320 g/cm3 to about 0.9350 g/cm3 measured by ASTM D1505-18 using sample preparation according to ASTM 02839-16.

Classes IPC  ?

• C08F 110/02 - Éthylène

Abrégé

Aluminosilicate zeolites, designated as EMM-63, characterized by a unique powder XRD pattern or unique connectivities, methods of making the same, and uses thereof.

Classes IPC  ?

• B01J 20/18 - Tamis moléculaires zéolitiques synthétiques
• B01J 20/30 - Procédés de préparation, de régénération ou de réactivation
• B01J 29/70 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes de types caractérisés par leur structure spécifique non prévus dans les groupes
• B01J 35/61 - Surface spécifique
• B01J 35/63 - Volume des pores

Abrégé

A method may include: providing bio waste stream wherein the bio waste stream comprises at least one bio waste selected from the group consisting of palm oil mill effluent, soapstock, and combinations thereof; introducing the bio waste effluent stream into a fluidized catalytic cracking unit; contacting the bio waste with a catalyst in the fluidized catalytic cracking unit; and cracking at least a portion of the bio waste stream to form cracked products that comprise a cracked product stream.

Classes IPC  ?

• C10G 3/00 - Production de mélanges liquides d'hydrocarbures à partir de matières organiques contenant de l'oxygène, p. ex. huiles, acides gras
• B01D 3/14 - Distillation fractionnée
• B01J 8/18 - Procédés chimiques ou physiques en général, conduits en présence de fluides et de particules solidesAppareillage pour de tels procédés les particules étant fluidisées
• B01J 8/24 - Procédés chimiques ou physiques en général, conduits en présence de fluides et de particules solidesAppareillage pour de tels procédés les particules étant fluidisées selon la technique du "lit fluidisé"
• B01J 19/24 - Réacteurs fixes sans élément interne mobile
• C10L 1/04 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures
• C11C 3/00 - Graisses, huiles ou acides gras obtenus par transformation chimique des graisses, huiles ou acides gras, p. ex. ozonolyse

Abrégé

A process for producing a C2-C4 olefin product from an ethane-containing hydrocarbon feed can be carried out using a steam cracker operated, with an elevated coil-outlet pressure, thereby reducing the number of stages of compression required for recovering products from the steam cracker effluent. Coke can be effectively managed in the processes of this disclosure.

Classes IPC  ?

• C07C 5/327 - Formation de liaisons doubles carbone-carbone uniquement non aromatiques
• C07C 11/04 - Éthylène
• C10G 9/20 - Fours tubulaires
• C10G 9/36 - Craquage thermique non catalytique, en l'absence d'hydrogène, des huiles d'hydrocarbures par contact direct avec des fluides inertes préchauffés, p. ex. avec des métaux ou sels fondus avec des gaz ou vapeurs chauds

Abrégé

A process for producing a C2-C4 olefin product from an ethane-containing hydrocarbon feed can be carried out using a steam cracker operated with an elevated coil-outlet pressure, thereby reducing the number of stages of compression required for recovering products from the steam cracker effluent. Coke can be effectively managed in the processes of this disclosure.

Classes IPC  ?

• C07C 5/327 - Formation de liaisons doubles carbone-carbone uniquement non aromatiques
• B01D 3/38 - Distillation par entraînement à la vapeur
• B01J 6/00 - CalcinationCuisson
• C02F 1/04 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par chauffage par distillation ou évaporation
• C02F 101/10 - Composés inorganiques
• C02F 101/32 - Hydrocarbures, p. ex. huiles
• C10G 9/36 - Craquage thermique non catalytique, en l'absence d'hydrogène, des huiles d'hydrocarbures par contact direct avec des fluides inertes préchauffés, p. ex. avec des métaux ou sels fondus avec des gaz ou vapeurs chauds

Abrégé

The present disclosure provides mesoporous catalyst compounds and compositions having one or more group 13 atoms. The present disclosure further relates to processes for converting hydrocarbon feedstocks to small olefins. In one aspect, a catalyst compound includes a zeolite having a structural type selected from MFI, MSE, MTW, Theta-One (TON), Ferrierite (FER), AFI, AFS, ATO, BEA, BEC, BOG, BPH, CAN, CON, EMT, EON, EZT, FAU, GME, GON, IFR, ISV, ITN, IWR, IWW, LTL, MAZ, MEI, MOR, MOZ, OFF, OKO, OSI, SAF, SAO, SEW, SFE, SFO, SSF, SSY, and USI, or a combination thereof, the zeolite having a silicon to aluminum molar ratio (Si/Al ratio) of from about 5 to about 40. In one aspect, a catalyst composition includes the catalyst compound and one or more group 13 metal.

Classes IPC  ?

• B01J 29/70 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes de types caractérisés par leur structure spécifique non prévus dans les groupes
• B01J 35/30 - Catalyseurs caractérisés par leur forme ou leurs propriétés physiques, en général caractérisés par leurs propriétés physiques
• B01J 35/61 - Surface spécifique
• B01J 35/63 - Volume des pores
• B01J 37/02 - Imprégnation, revêtement ou précipitation

Abrégé

Processes and systems for stabilizing the operation of a steam cracker primary fractionator. In some embodiments, the process can include (I) feeding a. first steam cracker effluent into a steam cracker primary fractionator. The process can also include (II) feeding a make-up liquid stream into the steam cracker primary fractionator. The process can also include (III) recovering a steam cracker gas oil ("SCGO'') side stream from the steam cracker primary fractionator. The process can also include (IV) recovering a steam cracker tar ("SCT'') stream from a location at and/or in the vicinity of a bottom of the primary fractionator. The make-up liquid stream can include a. first hydrocarbon portion and a second hydrocarbon portion. The first hydrocarbon portion can be distributed into the SCGO side stream. The second hydrocarbon portion can be distributed into the SCT stream.

Classes IPC  ?

• C10G 7/00 - Distillation des huiles d'hydrocarbures
• B01D 3/00 - Distillation ou procédés d'échange apparentés dans lesquels des liquides sont en contact avec des milieux gazeux, p. ex. extraction
• C10G 9/00 - Craquage thermique non catalytique, en l'absence d'hydrogène, des huiles d'hydrocarbures
• C10G 9/36 - Craquage thermique non catalytique, en l'absence d'hydrogène, des huiles d'hydrocarbures par contact direct avec des fluides inertes préchauffés, p. ex. avec des métaux ou sels fondus avec des gaz ou vapeurs chauds
• C10G 11/18 - Craquage catalytique, en l'absence d'hydrogène, des huiles d'hydrocarbures avec catalyseurs solides mobiles préchauffés selon la technique du "lit fluidisé"
• C10G 57/00 - Traitement des huiles d'hydrocarbures, en l'absence d'hydrogène, par au moins un procédé de craquage ou de raffinage et au moins un autre procédé de conversion

Abrégé

Grease compositions may be made from an oil basestock. For example, a grease composition may include: an oil basestock having: a kinematic viscosity (ASTM D445, 40° C.) of from 320 cSt to 520 cSt, a kinematic viscosity (ASTM D445, 100° C.) of from 22 cSt to 36 cSt, a viscosity index (ASTM D2270) of from 80 to 119, a pour point (ASTM D97) of −6° C. or less, and a saturate content (ASTM D7419) of 90 wt % or greater; and from 0.5 wt % to 15 wt % of a thickener, by total weight of the grease composition.

Classes IPC  ?

• C10M 169/02 - Mélanges de matériaux de base et d'épaississants
• C10M 101/02 - Fractions de pétrole
• C10M 117/02 - Compositions lubrifiantes caractérisées en ce que l'épaississant est un acide carboxylique non macromoléculaire ou ses sels comportant un seul groupe carboxyle lié à un atome de carbone acyclique ou cycloaliphatique ou à l'hydrogène
• C10N 20/02 - ViscositéIndice de viscosité
• C10N 30/00 - Propriétés physiques ou chimiques particulières améliorées par l'additif caractérisant la composition lubrifiante, p. ex. additifs multifonctionnels
• C10N 30/02 - Point d'écoulementIndice de viscosité
• C10N 30/06 - OnctuositéRésistance du filmAnti-usureRésistance aux pressions extrêmes
• C10N 50/10 - Forme sous laquelle est appliqué le lubrifiant au matériau à lubrifier semi-solideForme sous laquelle est appliqué le lubrifiant au matériau à lubrifier huileuse
• C10N 70/00 - Procédés particuliers de préparation

Abrégé

Grease compositions may be made from an oil basestock. For example, a grease composition may include: an oil basestock having: a kinematic viscosity (ASTM D445, 40°C) of from 320 cSt to 520 cSt, a kinematic viscosity (ASTM D445, 100°C) of from 22 cSt to 36 cSt, a viscosity index (ASTM D2270) of from 80 to 119, a pour point (ASTM D97) of -6°C or less, and a saturate content (ASTM D7419) of 90 wt% or greater; and from 0.5 wt% to 15 wt% of a thickener, by total weight of the grease composition.

Classes IPC  ?

• C10M 169/02 - Mélanges de matériaux de base et d'épaississants

Abrégé

Methods of processing optical data generated by a distributed fiber optic sensing system (30) and hydrocarbon industrial infrastructure (10) that performs the methods. The methods include repeatedly providing (115) an input optical signal (52) to a fiber optic cable (40) and repeatedly receiving (120) an output optical signal (62), which includes optical data regarding a local environment of the fiber optic cable, from the fiber optic cable. The methods also include generating (125) an output data stream (64) that is based upon the output optical signal, comparing (135) the output data stream to reference output data, detecting (140) anomalous behavior, and analyzing (145) the subset of the optical data. The methods further include downsampling (150) the output data stream utilizing a predetermined decimation algorithm to generate a decimated output data stream (84).

Classes IPC  ?

• G01D 5/353 - Moyens mécaniques pour le transfert de la grandeur de sortie d'un organe sensibleMoyens pour convertir la grandeur de sortie d'un organe sensible en une autre variable, lorsque la forme ou la nature de l'organe sensible n'imposent pas un moyen de conversion déterminéTransducteurs non spécialement adaptés à une variable particulière utilisant des moyens optiques, c.-à-d. utilisant de la lumière infrarouge, visible ou ultraviolette avec atténuation ou obturation complète ou partielle des rayons lumineux les rayons lumineux étant détectés par des cellules photo-électriques en modifiant les caractéristiques de transmission d'une fibre optique
• G01H 9/00 - Mesure des vibrations mécaniques ou des ondes ultrasonores, sonores ou infrasonores en utilisant des moyens sensibles aux radiations, p. ex. des moyens optiques
• G01D 3/08 - Dispositions pour la mesure prévues pour les objets particuliers indiqués dans les sous-groupes du présent groupe avec dispositions pour protéger l'appareil, p. ex. contre les fonctionnements anormaux, contre les pannes

Abrégé

Disclosed is a staged-air burner device capable of high energy efficiency, high flame stability, combusting multiple readily switchable fuels ranging from pure hydrogen, to any hydrogen/methane mixture, to pure methane, and generating a low level of NOx. The burner device can include: a primary air chamber receiving a primary air and a flue gas; a burner tube capable of receiving a fuel jet and drawing in the air-flue gas mixture from the primary air chamber; a burner tip discharging the fuel-air-flue gas mixture formed in the burner tube to a first combustion zone and a second combustion zone via center orifices and side orifices on the burner tip, respectively; and a staged air chamber receiving staged air and discharging it via staged air ports into a third combustion zone. Combustion of the fuel occurs in at least one of the first, second, and third combustion zones.

Classes IPC  ?

• F23C 6/04 - Appareils à combustion caractérisés par la combinaison d'au moins deux chambres de combustion disposées en série
• F23C 7/00 - Appareils à combustion caractérisés par des dispositions pour l'amenée d'air

Abrégé

Disclosed is a staged-air burner device capable of high energy efficiency, high flame stability- combusting multiple readily switchable fuels ranging from pure hydrogen, to any hydrogen/methane mixture, to pure methane, and generating a low level of NOx. 'The burner device can include: a primary air chamber receiving a primary air and a flue gas; a burner tube capable of receiving a fuel jet and drawing in the air-flue gas mixture from the primary air chamber: a. burner tip discharging the fuel-air-flue gas mixture formed in the burner tube to a first combustion zone and a second combustion zone via center orifices and side orifices on the burner tip, respectively, and a staged air chamber receiving staged air and discharging it via staged air ports into a. third combustion zone. Combustion of the fuel occurs in at least one of the first, second, and third combustion zones.

Classes IPC  ?

• F23C 6/04 - Appareils à combustion caractérisés par la combinaison d'au moins deux chambres de combustion disposées en série
• F23C 7/00 - Appareils à combustion caractérisés par des dispositions pour l'amenée d'air
• F23C 9/00 - Appareils à combustion caractérisés par des dispositions pour renvoyer les produits de combustion ou les gaz de fumée dans la chambre de combustion
• F23D 14/08 - Brûleurs à gaz avec prémélangeurs, c.-à-d. dans lesquels le combustible gazeux est mélangé à l'air de combustion en amont de la zone de combustion du type à induction, p. ex. becs Bunsen avec les orifices de sortie disposés axialement dans la tête de brûleur
• F23D 14/66 - Préchauffage de l'air de combustion ou du gaz
• F23L 7/00 - Alimentation du foyer en liquides ou gaz non combustibles autres que l'air, p. ex. oxygène, vapeur d'eau
• F23L 9/00 - Passages ou ouvertures pour introduire l'air secondaire nécessaire à la combustion complète du combustible
• F23M 5/02 - ArmaturesEnveloppesParois caractérisées par la forme des briques ou des blocs utilisés

Abrégé

A fluid coker reactor for producing coke suitable for use as proppant. Methods for producing said coke include: reacting a heavy oil feedstock in the coking zone of a fluid coker reactor to form a vapor phase and hot coke; stripping at least a portion of hydrocarbons that adhere to the hot coke in a stripping zone located in a lower portion of the fluid coker reactor; scrubbing the vapor phase from the fluid coker reactor in a scrubber; heating the hot coke in a heater, wherein the heater produces a coke product; recycling a portion of the hot coke from the heater to the coking zone of the fluid coker reactor; removing a recycle portion from the coke product; and recycling a recycle feed including the recycle portion to a feed line fluidly connected to the fluid coker reactor.

Classes IPC  ?

• C10B 55/10 - Cokéfaction des huiles minérales, bitumes, goudrons ou analogues, ou de leurs mélanges, avec des matières carbonées solides avec des matières solides avec des matières solides en mouvement sous forme dispersée selon la technique du "lit fluidisé"
• C10G 9/32 - Craquage thermique non catalytique, en l'absence d'hydrogène, des huiles d'hydrocarbures avec des matériaux solides mobiles préchauffés selon la technique du "lit fluidisé"

Abrégé

The present disclosure relates to ansa-metallocene catalyst compounds, catalyst systems comprising such compounds, and uses thereof. In some embodiments, a catalyst compound is represented by Formula (I): The present disclosure relates to ansa-metallocene catalyst compounds, catalyst systems comprising such compounds, and uses thereof. In some embodiments, a catalyst compound is represented by Formula (I): TyLAMXn-2   (I), The present disclosure relates to ansa-metallocene catalyst compounds, catalyst systems comprising such compounds, and uses thereof. In some embodiments, a catalyst compound is represented by Formula (I): TyLAMXn-2   (I), wherein: M is a group 3-6 metal; n is the oxidation state of M; A is a monocyclic or polycyclic arenyl ligand bonded to M and is substituted by at least one phenanthridin-5-yl substituent; L is a monocyclic or polycyclic arenyl ligand bonded to M; T is a bridging group; y is 1 or 0; and each X is independently a univalent anionic ligand, or two Xs are joined and bound to M to form a metallocycle ring, or two Xs are joined to form a chelating ligand, a diene ligand, or an alkylidene ligand.

Classes IPC  ?

• C07F 17/00 - Metallocènes
• C08F 10/02 - Éthylène
• C08F 10/04 - Monomères contenant trois ou quatre atomes de carbone
• C08F 10/06 - Propène
• C08F 10/14 - Monomères contenant au moins cinq atomes de carbone

Abrégé

Some examples include systems and methods for monitoring emission indications. A system has an image sensor to capture an image of a flare stack. A computer vision engine is configured to determine whether an emission indicator captured by the image indicates an emission event. A server engine is configured to transmit a notification indicating whether the emission indicator indicates the emission event to a control system of the flare stack. The computer vision engine is configured to update one or more model settings, one or more thresholds, or a combination thereof based on one or more settings. In one embodiment, the computer vision engine is configured to identify, using a deep convolutional neural network (DCNN) model, the emission indicator captured by the image.

Classes IPC  ?

• G06V 20/50 - Contexte ou environnement de l’image
• F23G 7/08 - Procédés ou appareils, p. ex. incinérateurs, spécialement adaptés à la combustion de déchets particuliers ou de combustibles pauvres, p. ex. des produits chimiques de gaz d'évacuation ou de gaz nocifs, p. ex. de gaz d'échappement utilisant des torchères, p. ex. dans des cheminées
• G06V 10/26 - Segmentation de formes dans le champ d’imageDécoupage ou fusion d’éléments d’image visant à établir la région de motif, p. ex. techniques de regroupementDétection d’occlusion
• G06V 10/82 - Dispositions pour la reconnaissance ou la compréhension d’images ou de vidéos utilisant la reconnaissance de formes ou l’apprentissage automatique utilisant les réseaux neuronaux
• G06V 10/94 - Architectures logicielles ou matérielles spécialement adaptées à la compréhension d’images ou de vidéos

Abrégé

Grease compositions may be made from an oil basestock. For example, a grease composition may include: an oil basestock having: a kinematic viscosity (ASTM D445, 40° C.) of from 320 cSt to 520 cSt, a kinematic viscosity (ASTM D445, 100° C.) of from 22 cSt to 36 cSt, a viscosity index (ASTM D2270) of from 80 to 119, a pour point (ASTM D97) of −6° C. or less, and a saturate content (ASTM D7419) of 90 wt % or greater; and from 0.5 wt % to 15 wt % of a thickener, by total weight of the grease composition.

Classes IPC  ?

• C10M 101/00 - Compositions lubrifiantes, caractérisées en ce que le matériau de base est une huile minérale ou une huile grasse
• C10M 117/00 - Compositions lubrifiantes caractérisées en ce que l'épaississant est un acide carboxylique non macromoléculaire ou ses sels
• C10M 169/02 - Mélanges de matériaux de base et d'épaississants
• C10M 177/00 - Méthodes particulières de préparation des compositions lubrifiantesModification chimique par post-traitement des constituants ou de la composition lubrifiante elle-même, non couverte par d'autres classes
• C10N 10/02 - Groupes 1 ou 11
• C10N 20/02 - ViscositéIndice de viscosité
• C10N 70/00 - Procédés particuliers de préparation

Abrégé

The present disclosure relates to copolymer polyols, polyurethanes made using copolymer polyols, and methods thereof. In some embodiments, a copolymer is represented by Formula (I), Formula (II), Formula. (Ill), or Formula (IX) wherein each of Q1and Q2is independently hydrogen (A), (B) or (C); each instance of X is independently oxygen or sulfur; each instance of Raand Rbis independently hydrogen, ether, hydrocarbyl, or substituted hydrocarbyl, wherein Raand Rbmay combine to form a five-membered, six-membered, or seven- membered ring; n is zero a. positive integer of about 1 to about 100; each of m and p is independently a positive integer of 1 to 100 (m may be zero); and each instance of Rc is independently alkylene, vinylene, ether, carbonyl -containing hydrocarbon, or alkanoate.

Classes IPC  ?

• C08G 18/32 - Composés polyhydroxylésPolyaminesHydroxyamines
• C08G 18/40 - Composés de haut poids moléculaire
• C08G 18/42 - Polycondensats contenant des groupes ester carboxylique ou carbonique dans la chaîne principale
• C08G 18/44 - Polycarbonates
• C08G 18/48 - Polyéthers
• C08G 18/66 - Composés des groupes , ou
• C08G 18/76 - Polyisocyanates ou polyisothiocyanates cycliques aromatiques
• C08G 65/26 - Composés macromoléculaires obtenus par des réactions créant une liaison éther dans la chaîne principale de la macromolécule à partir d'éthers cycliques par ouverture d'un hétérocycle à partir d'éthers cycliques et d'autres composés
• C08G 18/16 - Catalyseurs
• C08G 63/64 - Polyesters contenant à la fois des groupes ester carboxylique et des groupes carbonate

Abrégé

A refractory-lined equipment includes a vessel that defines an interior and houses a bed of particles, a refractory material secured to an inner wall of the interior, a nozzle assembly coupled to and penetrating a sidewall of the vessel and extending into the interior. The nozzle assembly includes a support structure, and a refractory fluidization nozzle received within the support structure and including a dense outer layer that defines an interior flow passage, and a porous inner layer positioned within the interior flow passage. A fluid circulated through the porous inner layer and is discharged into the vessel as bubbles that fluidize the bed of particles, wherein the dense outer layer is composed of a refractory material that is impermeable to the fluid, and the porous inner layer is composed of a refractory material that is permeable to the fluid.

Classes IPC  ?

• B01J 8/00 - Procédés chimiques ou physiques en général, conduits en présence de fluides et de particules solidesAppareillage pour de tels procédés
• B01J 8/18 - Procédés chimiques ou physiques en général, conduits en présence de fluides et de particules solidesAppareillage pour de tels procédés les particules étant fluidisées
• B01J 19/02 - Appareils caractérisés par le fait qu'ils sont construits avec des matériaux choisis pour leurs propriétés de résistance aux agents chimiques

Abrégé

An electric furnace may be used for heating a feedstock to a delayed coker. For example, a method for delayed coking may include heating a feedstock in an electric furnace that includes an electric heater, wherein the feedstock includes petroleum resid; conveying the heated feedstock to a delayed coker drum fluidly connected to and downstream of the electric furnace; and producing solid coke from the heated feedstock in the delayed coker drum.

Classes IPC  ?

• C10B 55/00 - Cokéfaction des huiles minérales, bitumes, goudrons ou analogues, ou de leurs mélanges, avec des matières carbonées solides
• C10G 9/00 - Craquage thermique non catalytique, en l'absence d'hydrogène, des huiles d'hydrocarbures

Abrégé

Disclosed herein are a variety of systems, compositions, and methods for reversibly storing electrical energy in a symmetric redox flow battery with a unit cell potential equal to or greater than 3 volts. The systems include a conjugated organic molecule, a positive section, and a negative section. The conjugated organic molecule comprises a pair of electron-donating groups and a pair of electron-withdrawing groups, wherein a first electron-donating group of the electron donating groups is one ring position from a first electron-withdrawing group of the electron-withdrawing groups, and wherein a second electron-donating group is one ring position from a second electron-withdrawing group of the electron-withdrawing groups. The positive section includes a first metal electrode in contact with a catholyte comprising a portion of the conjugated organic molecule. The negative section comprises a second metal electrode in contact with an anolyte including an additional portion of the conjugated organic molecule.

Classes IPC  ?

• H01M 8/18 - Éléments à combustible à régénération, p. ex. batteries à flux REDOX ou éléments à combustible secondaires
• H01M 8/24 - Groupement d'éléments à combustible, p. ex. empilement d'éléments à combustible

Abrégé

Age differentiation of hydrocarbon samples may be achieved using a chemical fossil assemblage approach. For example, a method may comprise: determining a source facies for a hydrocarbon sample; inputting the source facies into a chemical fossil assemblage model; determining, using the chemical fossil assemblage model, one or more candidate chemical fossil assemblages and corresponding age biomarkers for the hydrocarbon sample based on the source facies; measuring a concentration or a related value of corresponding age biomarkers in the hydrocarbon sample to yield an age biomarker fingerprint; inputting the age biomarker fingerprint into a chemical fossil assemblage model; comparing the age biomarker fingerprint to the one or more candidate chemical fossil assemblages using the chemical fossil assemblage model; and estimating an age of the hydrocarbon sample based on the comparison.

Classes IPC  ?

• G01N 33/28 - Huiles
• E21B 43/00 - Procédés ou dispositifs pour l'extraction de pétrole, de gaz, d'eau ou de matériaux solubles ou fusibles ou d'une suspension de matières minérales à partir de puits
• E21B 44/00 - Systèmes de commande automatique spécialement adaptés aux opérations de forage, c.-à-d. systèmes à fonctionnement autonome ayant pour rôle d'exécuter ou de modifier une opération de forage sans l'intervention d'un opérateur humain, p. ex. systèmes de forage commandés par ordinateurSystèmes spécialement adaptés à la surveillance de plusieurs variables ou conditions de forage

Abrégé

A method for adjusting the treatment schedule for a hydraulic fracturing operation corresponding to a hydrocarbon well to limit one or more pumping parameters (e.g., the pump time, pump volume, and/or pump rate) includes analyzing fracture diagnostic data and/or fracture model data to estimate the pumping parameter(s) at which the maximum number of hydraulic fractures will approximate a target fracture dimension during the hydraulic fracturing operation. The method also includes adjusting the treatment schedule for the hydraulic fracturing operation based on the estimated pumping parameter(s) and then hydraulic fracturing the hydrocarbon well according to the adjusted treatment schedule.

Classes IPC  ?

• E21B 43/26 - Procédés pour activer la production par formation de crevasses ou de fractures
• E21B 47/06 - Mesure de la température ou de la pression
• E21B 49/00 - Test pour déterminer la nature des parois des trous de forageEssais de couchesProcédés ou appareils pour prélever des échantillons du terrain ou de fluides en provenance des puits, spécialement adaptés au forage du sol ou aux puits

Abrégé

An electric submersible pump (ESP) system is described herein. The ESP system includes a pump and a motor connected to drive the pump. The pump and motor are disposed to pump fluid into production tubing in a wellbore. The motor produces heat when operating. The wellbore contains wellbore fluids. A seal unit is connected between the motor and the pump. The seal unit contains oil to lubricate the motor. Further, the seal unit receives heat from the motor when the motor is running. The seal unit contains a structure to reduce loss of heat after the motor stops running to reduce an exchange of oil from the seal unit to the wellbore and to reduce an exchange of wellbore fluids from the wellbore to the seal unit.

Classes IPC  ?

• E21B 33/12 - PackersBouchons
• E21B 43/10 - Mise en place de tubages, filtres ou crépines dans les puits
• E21B 43/12 - Procédés ou appareils pour commander l'écoulement du fluide extrait vers ou dans les puits

Abrégé

A reversible epoxy polymer obtainable by the reaction between at least one epoxy compound and at least one curing agent, wherein at least part of the epoxy compound contains one reversible borate moiety or derivative thereof per molecule; and/or at least part of the curing agent contains one reversible borate moiety or derivative thereof per molecule; and/or the reaction system further comprises at least one compound containing hydroxyl and epoxy group and at least one BQH-containing compound or its ester derivative, wherein said BQH-containing compound contains two or more B-QH moieties, and wherein the derivative of borate moiety represents a moiety with the oxygen in the borate moiety being replaced with other element of the sixth main group and wherein each Q is independently an element of the sixth main group.

Classes IPC  ?

• C08G 59/40 - Macromolécules obtenues par polymérisation à partir de composés contenant plusieurs groupes époxyde par molécule en utilisant des agents de durcissement ou des catalyseurs qui réagissent avec les groupes époxyde caractérisées par les agents de durcissement utilisés
• C07F 5/04 - Esters des acides boriques
• C08G 59/24 - Composés diépoxydés carbocycliques

Abrégé

A method may include: introducing a stream comprising a vacuum gas oil into a liquid-liquid extraction unit; contacting the vacuum gas oil with a dihydrolevoglucosenone solvent to extract a portion of aromatic compounds from the vacuum gas oil to produce a raffinate stream with reduced aromatic compound concentration; and dewaxing the raffinate stream to form a base stock.

Classes IPC  ?

• C10G 9/00 - Craquage thermique non catalytique, en l'absence d'hydrogène, des huiles d'hydrocarbures
• C10G 45/32 - Hydrogénation sélective des composés dioléfiniques ou acétyléniques
• C10G 45/44 - Hydrogénation des hydrocarbures aromatiques
• C10G 67/04 - Traitement des huiles d'hydrocarbures, uniquement par au moins un procédé d'hydrotraitement et au moins un procédé de raffinage en l'absence d'hydrogène uniquement par plusieurs étapes en série comprenant une extraction par solvant comme étape de raffinage en l'absence d'hydrogène
• C10G 67/14 - Traitement des huiles d'hydrocarbures, uniquement par au moins un procédé d'hydrotraitement et au moins un procédé de raffinage en l'absence d'hydrogène uniquement par plusieurs étapes en série comprenant au moins deux étapes de raffinage différentes, en l'absence d'hydrogène
• C10G 69/06 - Traitement des huiles d'hydrocarbures par au moins un procédé d'hydrotraitement et au moins un autre procédé de conversion uniquement par plusieurs étapes en série comprenant au moins une étape de craquage thermique en l'absence d'hydrogène

Abrégé

Methods of synthesizing crystalline metal-organic frameworks (MOFs) having polytopic organic linkers and, cations, where each linker is connected, to two or more cations, are provided. In the disclosed methods, the linkers are reacted with one or more compounds of formula MnXm, where each M is independently cationic Be, Mg, Ca, Ti, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Zr, Nb, Mo, Ru, Rh, Pd, Cd, or Hf, X is anionic, n and m are integers. The reaction is performed in the presence of a salicylate, salicylamide, 1,3-phthalate, or hydroxybenzoate based modulator.

Classes IPC  ?

• C07F 15/06 - Composés du cobalt

Abrégé

Molecular sieves, designated as EMM-75, characterized by a unique powder XRD pattern, methods of making the same, and uses thereof.

Classes IPC  ?

• C01B 39/26 - Type mordenite

Abrégé

Molecular sieves, designated as EMM-75, characterized by a unique powder XRD pattern, methods of making the same, and uses thereof.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique
• B01J 29/70 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes de types caractérisés par leur structure spécifique non prévus dans les groupes
• B01J 37/00 - Procédés de préparation des catalyseurs, en généralProcédés d'activation des catalyseurs, en général
• B01J 37/03 - PrécipitationCo-précipitation
• C07D 235/08 - Radicaux ne contenant que des atomes d'hydrogène et de carbone

Abrégé

A variety of methods and thermoset polymer products are disclosed, including a method comprising nitrating at least a portion of an aromatic feed to produce a mixture of isomers of nitrated aromatic compounds, hydrogenating at least a portion of the mixture of isomers of nitrated aromatic compounds to produce a mixture of isomers of aromatic amine monomers, and reacting the mixture of isomers of aromatic amines with an epoxy resin to produce at least a thermoset polymer. In one or more embodiments, the thermoset polymer product comprises first repeating units of an epoxy group and a first tertiary amine having a first isomeric position, second repeating units of the epoxy group and a second tertiary amine having a second isomeric position, third repeating units of the epoxy group and a third tertiary amine having a third isomeric position, wherein the first, second, and third isomeric positions are different.

Classes IPC  ?

• C08G 59/50 - Amines
• C07C 211/43 - Composés contenant des groupes amino liés à un squelette carboné ayant des groupes amino liés à des atomes de carbone de cycles aromatiques à six chaînons du squelette carboné