Abrégé

Disclosed herein are a variety of systems, compositions, and methods for reversibly storing electrical energy in a redox flow battery with a unit cell potential equal to or greater than 3.5 volts. The systems include a positive section, a negative section, and an electroactive bipolar redox molecule comprising an anolyte moiety and a catholyte moiety separated by a non-conjugating insulating linker. The catholyte moiety comprises para-dimethoxybenzene and the non-conjugating insulating linker comprises at least two -CX2 linkers, wherein X comprises at least one atom selected from the group consisting of hydrogen and heteroatoms. The positive section comprises a first metal electrode in contact with the electroactive bipolar redox molecule and a supporting electrolyte dissolved in a solvent. The negative section comprises a second metal electrode in contact with the electroactive bipolar redox molecule and additional electrolyte dissolved in additional solvent.

Classes IPC  ?

• H01M 8/04186 - Dispositions pour la commande des paramètres des réactifs, p. ex. de la pression ou de la concentration des réactifs chargés en liquide ou en électrolyte
• H01M 8/18 - Éléments à combustible à régénération, p. ex. batteries à flux REDOX ou éléments à combustible secondaires

Abrégé

Provided herein is a method for purifying isopropanol, comprising (a) providing a feed comprising at least 99.0 wt% isopropanol; and (b) subjecting said feed to two or more distillation steps, including a higher-pressure distillation at a pressure of at least 6 bar; and a 5 lower-pressure distillation at a pressure below bar; thereby obtaining purified isopropanol.

Classes IPC  ?

• C07C 29/80 - SéparationPurificationStabilisationEmploi d'additifs par traitement physique par distillation
• C07C 31/10 - Alcools monohydroxyliques acycliques contenant trois atomes de carbone

Abrégé

The present disclosure relates to a method of making crystalline materials of *BEA framework type. The present disclosure also relates to crystalline materials of *BEA framework type obtainable by said method and uses thereof. The method of making includes using 1,1-(pentane-1,5-diyl)bis(1-propylpyrrolidinium) dication as a structure directing agent for forming the crystalline materials of *BEA framework type.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique
• B01J 29/70 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes de types caractérisés par leur structure spécifique non prévus dans les groupes

Abrégé

The present disclosure relates to a method of making crystalline materials of *BEA framework type. The present disclosure also relates to crystalline materials of *BEA framework type obtainable by said method and uses thereof. The method of making includes using 1,1-(pentane-1,5-diyl)bis(1-propylpyrrolidinium) dication as a structure directing agent for forming the crystalline materials of *BEA framework type.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique

Abrégé

A method involves storing gas in a subsurface region of a hydrocarbon reservoir. The method includes injecting a barrier forming solution into the subsurface region. The method also includes injecting a driving solution into the subsurface region. The driving solution drives the barrier-forming solution to form a low permeability barrier bounded on the top by caprock. The method further includes injecting a gas into the subsurface region. The gas is stored under the caprock and within a gas storage region formed by the low permeability barrier.

Classes IPC  ?

• E21B 41/00 - Matériel ou accessoires non couverts par les groupes
• B65G 5/00 - Emmagasinage des fluides dans des excavations ou cavités naturelles ou artificielles souterraines

Abrégé

Olefinic naphtha compositions are provided that can be incorporated into naphtha boiling range fuel products, such as gasolines. The olefinic naphtha compositions can be formed as part of a process for oligomerization of olefins to form jet boiling range compounds. It has been unexpectedly discovered that olefinic naphtha formed from such an oligomerization process can be used to form naphtha and/or gasoline blends that have reduced aromatics content while maintaining volumetric energy density and maintaining or increasing octane rating (RON and/or MON).

Classes IPC  ?

• C10L 1/06 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures pour allumage par bougie

Abrégé

A variety of methods, systems, and compositions are disclosed, including, in one embodiment, an additive manufacturing composition comprising an Fe—Cr—Ni alloy and a niobium-absorption element, wherein the Fe—Cr—Ni alloy has a niobium content of about 0.5% to about 5% by weight, wherein the niobium-absorption element forms a precipitate with niobium.

Classes IPC  ?

• B29C 64/165 - Procédés de fabrication additive utilisant une combinaison de matériaux solides et liquides, p. ex. une poudre avec liaison sélective par liant liquide, catalyseur, inhibiteur ou absorbeur d’énergie
• B29C 64/176 - Procédés de fabrication additive spécialement adaptés à la fabrication d'objets multiples en 3D successivement
• B29C 64/205 - Moyens d’application des couches

Abrégé

A variety of methods, systems, and compositions are disclosed, including, in one embodiment, an additive manufacturing composition comprising an Fe-Cr-Ni alloy and a niobium-absorption element, wherein the Fe-Cr-Ni alloy has a niobium content of about 0.5% to about 5% by weight, wherein the niobium-absorption element forms a precipitate with niobium.

Classes IPC  ?

• B22F 10/25 - Dépôt direct de particules métalliques, p. ex. dépôt direct de métal [DMD] ou mise en forme par laser [LENS]
• B22F 10/28 - Fusion sur lit de poudre, p. ex. fusion sélective par laser [FSL] ou fusion par faisceau d’électrons [EBM]
• B22F 10/38 - Commande ou régulation des opérations pour obtenir des caractéristiques spécifiques du produit, p. ex. le lissage de la surface, la densité, la porosité ou des structures creuses
• B33Y 10/00 - Procédés de fabrication additive
• B33Y 70/00 - Matériaux spécialement adaptés à la fabrication additive
• C22C 1/04 - Fabrication des alliages non ferreux par métallurgie des poudres
• C22C 19/05 - Alliages à base de nickel ou de cobalt, seuls ou ensemble à base de nickel avec du chrome
• C22C 33/02 - Fabrication des alliages ferreux par des techniques de la métallurgie des poudres
• C22C 38/48 - Alliages ferreux, p. ex. aciers alliés contenant du chrome et du nickel et du niobium ou du tantale
• B22F 9/08 - Fabrication des poudres métalliques ou de leurs suspensionsAppareils ou dispositifs spécialement adaptés à cet effet par des procédés physiques à partir d'un matériau liquide par coulée, p. ex. à travers de petits orifices ou dans l'eau, par atomisation ou pulvérisation
• B22F 10/32 - Commande ou régulation des opérations de l’atmosphère, p. ex. de la composition ou de la pression dans une chambre de fabrication
• B22F 12/52 - Trémies
• B22F 12/55 - Moyens multiples d’alimentation en matériau
• B22F 12/58 - Moyens d’alimentation en matériau, p. ex. têtes pour modifier la composition du matériau, p. ex. en mélangeant
• B33Y 30/00 - Appareils pour la fabrication additiveLeurs parties constitutives ou accessoires à cet effet
• B33Y 50/02 - Acquisition ou traitement de données pour la fabrication additive pour la commande ou la régulation de procédés de fabrication additive

Abrégé

Methods for forming thermally equilibrated liquefied gas mixtures may comprise: obtaining boil-off gas from a liquefied gas mixture comprising a first hydrocarbon and one or more second hydrocarbons; discharging the first hydrocarbon in liquefied form from a first reservoir and the one or more additional hydrocarbons in liquefied form from one or more second reservoirs at a mixing ratio sufficient to maintain the liquefied gas mixture at one or more specified physical parameters once blended therewith; performing indirect heat exchange between at least a portion of the boil-off gas and the one or more additional hydrocarbons discharged from the one or more second reservoirs until the one or more additional hydrocarbons are in thermal equilibrium with the boil-off gas; and combining the one or more additional hydrocarbons with the first hydrocarbon to form a thermally equilibrated liquefied hydrocarbon blend that is supplied to the liquefied gas mixture.

Classes IPC  ?

• C10L 3/12 - Gaz de pétrole liquéfié

Abrégé

High molecular weight elastomers, such as ethylene-propylene-diene monomer (EPDM) polymers, are conventionally formulated with a post-polymerization oil extension to mitigate their high Mooney viscosity. Post-polymerization oil extension adds to processing costs and precludes use of polymerization facilities lacking oil extension capabilities. A low molecular weight polymer may be co-produced with a high molecular weight elastomer containing the same monomers, where the low molecular weight polymer may function in place of conventional oil extension. Polymerization methods may form a polyolefin blend comprising first and second polyolefins having a bimodal molecular weight distribution.

Classes IPC  ?

• C08F 210/18 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP avec des diènes non conjugués, p. ex. caoutchoucs EPT
• C08F 4/64 - Titane, zirconium, hafnium ou leurs composés
• C08F 4/6592 - Composant couvert par le groupe contenant une liaison métal de transition-carbone contenant au moins un cycle cyclopentadiényle, condensé ou non, p. ex. un cycle indényle ou fluorényle
• C08F 210/16 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP

Abrégé

Systems and methods are provided for conversion of ethylene-containing feeds to fuels boiling range compounds, such as jet boiling range compounds. It has unexpectedly been discovered that improved conversion of ethylene-containing feeds can be achieved in a single stage at temperatures of 250°C or less using a MWW framework catalyst that is substantially free of supported metals.

Classes IPC  ?

• C10G 50/00 - Production de mélanges d'hydrocarbures liquides à partir d'hydrocarbures à nombre inférieur d'atomes de carbone, p. ex. par oligomérisation
• B01J 29/70 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes de types caractérisés par leur structure spécifique non prévus dans les groupes
• C07C 2/12 - Procédés catalytiques avec des alumino-silicates cristallins, p. ex. avec des tamis moléculaires
• C07C 2/24 - Procédés catalytiques avec des métaux
• C07C 11/04 - Éthylène

Abrégé

Processes for making propylene-based copolymers having broad molecular weight distributions and broad comonomer distributions using a single tubular reactor. Processes for making a propylene-based copolymer can include introducing propylene and at least one other olefin comonomer to a tubular reactor to produce a propylene-based copolymer having a broad comonomer distribution, a Mw of about 10 kg/mol to about 2.000 kg/mol, and a MWD of about 2.0 to about 10.0. The tubular reactor can include one or more heat exchanger elements, preferably a spiral heat exchanger. Propylene-based copolymer compositions can include propylene derived units and at least one other comonomer derived units, wherein the copolymer compositions have a broad comonomer distribution, a Mw of about 10 kg/mol to about 2.000 kg/mol, and a MWD of about 2.0 to about 10.0. Such compositions can have broad orthogonal comonomer distributions.

Classes IPC  ?

• C08F 10/06 - Propène

Abrégé

A method for producing a blended jet boiling range composition stream may include: oligomerizing an ethylene stream to a C4+ olefin stream in a first olefin oligomerization unit, wherein the C4+ olefin stream contains no greater than 10 wt % of methane, ethylene, and ethane combined; wherein the ethylene stream contains at least 50 wt % ethylene, at least 2000 wppm ethane, no greater than 1000 wppm of methane, and no greater than 20 wppm each of carbon monoxide and hydrogen; oligomerizing the C4+ olefin stream and a propylene/C4+ olefin stream in a second oligomerization unit to produce an isoolefinic stream; subjecting at least a portion of the isoolefinic stream to a hydroprocessing process with hydrogen as treat gas to produce an isoparaffinic stream having no greater than 10 wt % olefin content; and using least a portion of the isoparaffinic stream to create the blended jet boiling range.

Classes IPC  ?

• C10G 69/12 - Traitement des huiles d'hydrocarbures par au moins un procédé d'hydrotraitement et au moins un autre procédé de conversion uniquement par plusieurs étapes en série comprenant au moins une étape de polymérisation ou d'alkylation
• B01D 3/14 - Distillation fractionnée
• C07C 1/24 - Préparation d'hydrocarbures à partir d'un ou plusieurs composés, aucun d'eux n'étant un hydrocarbure à partir de composés organiques ne renfermant que des atomes d'oxygène en tant qu'hétéro-atomes par élimination d'eau
• C07C 2/08 - Procédés catalytiques
• C07C 2/12 - Procédés catalytiques avec des alumino-silicates cristallins, p. ex. avec des tamis moléculaires
• C07C 5/03 - Préparation d'hydrocarbures à partir d'hydrocarbures contenant le même nombre d'atomes de carbone par hydrogénation de liaisons doubles carbone-carbone non aromatiques
• C07C 7/04 - Purification, séparation ou stabilisation d'hydrocarburesEmploi d'additifs par distillation
• C07C 7/08 - Purification, séparation ou stabilisation d'hydrocarburesEmploi d'additifs par distillation à l'aide de composés auxiliaires extractive
• C10L 1/08 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures pour allumage par compression

Abrégé

The present disclosure relates to a method of making zeolites of BOG framework type, in particular a direct synthesis method for the preparation of aluminosilicate zeolites of BOG framework type using 5-azaindolium cations as structure directing agents. The present disclosure also relates to small crystal forms of aluminosilicate zeolites of BOG framework type and uses thereof.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique
• B01J 29/00 - Catalyseurs contenant des tamis moléculaires

Abrégé

Systems and methods are provided for using molten carbonate fuel cells (MCFCs) to reduce, minimize, and/or avoid CO2 emissions in a marine vessel environment. The systems and methods can include operation of MCFCs on a marine vessel under high fuel utilization conditions in order to provide power and capture CO2. The high fuel utilization conditions can allow for mitigation of CO2 over extended periods of time in spite of the challenges of performing CO2 mitigation in a potentially isolated environment such as a marine vessel. Additionally, the high fuel utilization can also reduce or minimize exhaust of fuels, such as methane, to the environment.

Classes IPC  ?

• H01M 8/0668 - Élimination du monoxyde de carbone ou du dioxyde de carbone
• H01M 8/04014 - Échange de chaleur par des fluides gazeuxÉchange de chaleur par combustion des réactifs
• H01M 8/0612 - Combinaison d’éléments à combustible avec des moyens de production de réactifs ou pour le traitement de résidus avec des moyens de production des réactifs gazeux à partir de matériaux contenant du carbone
• H01M 8/14 - Éléments à combustible avec électrolytes fondus

Abrégé

Systems and methods are provided for using a two-step process to capture CO2 from a process flue gas in an aqueous solution followed by conversion of the captured CO2 into metal carbonates for storage, transport, or other potential uses. In the first processing step, CO2 is removed from a process flue gas by contacting the process flue gas with an aqueous solution at a sufficiently high pH to enhance capture of the CO2 while reducing or minimizing other impacts on the vessel where capture is performed. The CO2-enriched aqueous solution is then passed into a second zone, such as a second vessel, for contact with a metal reagent, such as a metal oxide, metal sulfide, metal hydroxide, and/or metal silicate.

Classes IPC  ?

• C01F 11/18 - Carbonates
• B01D 53/62 - Oxydes de carbone
• B01D 53/78 - Procédés en phase liquide avec un contact gaz-liquide
• C01F 5/24 - Carbonates de magnésium

Abrégé

Systems and methods are provided for increasing the yield of products generated during co-processing of biomass oil in a fluid catalytic cracking (FCC) system. The systems and methods can allow for increased yield by reducing or minimizing formation of carbon oxides, gas phase products, and/or coke yields during the co-processing. This can be achieved by adding a hydrogen-rich co-feed to the co-processing environment. Examples of hydrogen-rich co-feeds include high hydrogen content vacuum gas oil co-feed, high hydrogen content distillate co-feed, and/or high hydrogen content naphtha co-feed. Additionally or alternately, various types of fractions that contain a sufficient amount of hydrogen donor compounds can be used to reduce or minimize carbon oxide formation.

Classes IPC  ?

• C10G 3/00 - Production de mélanges liquides d'hydrocarbures à partir de matières organiques contenant de l'oxygène, p. ex. huiles, acides gras

Abrégé

822222 mitigation in a potentially isolated environment such as a marine vessel. Additionally, the high fuel utilization can also reduce or minimize exhaust of fuels, such as methane, to the environment.

Classes IPC  ?

• H01M 8/0668 - Élimination du monoxyde de carbone ou du dioxyde de carbone
• H01M 8/04791 - ConcentrationDensité
• H01M 8/0612 - Combinaison d’éléments à combustible avec des moyens de production de réactifs ou pour le traitement de résidus avec des moyens de production des réactifs gazeux à partir de matériaux contenant du carbone
• H01M 8/0637 - Reformage interne direct à l’anode de l’élément à combustible
• H01M 8/14 - Éléments à combustible avec électrolytes fondus

Abrégé

A method for monitor-centric interpretation of offset pressure monitoring measurements includes simultaneously hydraulic fracturing treatment stages corresponding to treatment wells, measuring corresponding pressure data via pressure gauge(s) at monitor well(s), detecting pressure responses corresponding to fracture hits within the pressure data, and determining a reasonable velocity window for when a fracture originating from each treatment stage is likely to affect the pressure data. The method includes detecting treatment stage(s) that are likely to be the origin of each fracture hit based on the reasonable velocity window and, for each fracture hit that only has one likely originating treatment stage, assigning the detected fracture hit to such treatment stage. The method includes determining observation property data corresponding to the treatment stages that have been assigned to the fracture hits and iteratively assigning, based on such data, each unassigned fracture hit to one of the corresponding likely originating treatment stages.

Classes IPC  ?

• E21B 49/00 - Test pour déterminer la nature des parois des trous de forageEssais de couchesProcédés ou appareils pour prélever des échantillons du terrain ou de fluides en provenance des puits, spécialement adaptés au forage du sol ou aux puits
• E21B 43/26 - Procédés pour activer la production par formation de crevasses ou de fractures
• E21B 47/06 - Mesure de la température ou de la pression

Abrégé

The present disclosure relates to a method of making zeolites of BOG framework type, in particular a direct synthesis method for the preparation of aluminosilicate zeolites of BOG framework type using 5-azaindolium cations as structure directing agents. The present disclosure also relates to small crystal forms of aluminosilicate zeolites of BOG framework type and uses thereof.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique

Abrégé

24420+20+ hydrocarbons in high yields.

Classes IPC  ?

• C08J 11/12 - Récupération ou traitement des résidus des polymères par coupure des chaînes moléculaires des polymères ou rupture des liaisons de réticulation par voie chimique, p. ex. dévulcanisation uniquement par traitement à la chaleur sèche
• C08J 11/16 - Récupération ou traitement des résidus des polymères par coupure des chaînes moléculaires des polymères ou rupture des liaisons de réticulation par voie chimique, p. ex. dévulcanisation par traitement avec une substance inorganique

Abrégé

222222-enriched aqueous solution is then passed into a second zone, such as a second vessel, for contact with a metal reagent, such as a metal oxide, metal sulfide, metal hydroxide, and/or metal silicate.

Classes IPC  ?

• B01D 53/62 - Oxydes de carbone

Abrégé

The present disclosure relates to polyethylene compositions, articles (e.g., films) including such polyethylene compositions, and methods of making polyethylene compositions and articles (e.g., films) thereof. The polyethylene composition comprises 80 wt % or greater ethylene-derived units; has density within the range from 0.940 to 0.975 g/cm3; a melt index (MI) of 0.1 to 3.0 g/10 min (such as 0.5 g/10 min to 2.5 g/10 min); a high load melt index (HLMI) within the range from 60 g/10 min to 150 g/10 min; a melt index ratio (MIR, defined as HILMI/MI) greater than 50; and has a crossover frequency (COF) according to the following relationship: COF>−0.00015*(Mw)+80 (where COF is in rad/s and Mw is weight-average molecular weight in g/mol).

Classes IPC  ?

• C08F 10/02 - Éthylène
• C08J 5/18 - Fabrication de bandes ou de feuilles

Abrégé

A distillate boiling range composition is provided with an unexpected distribution of carbon chain lengths for the hydrocarbons in the composition. The composition corresponds to a distillate boiling range composition with a relatively narrow boiling range. Additionally, the narrow boiling range composition can have unexpectedly beneficial cold flow properties.

Classes IPC  ?

• C10L 1/04 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures

Abrégé

Methods and compositions for processing polymers with fluorine-free polymer processing aids (PPAs) are described. The methods can include continuously extruding a polymer composition through an extruder to form a polymer product, and during at least a portion of the extruding, continually feeding a polyethylene glycol (PEG) composite to the extruder so that the PEG composite and polymer composition are coextruded through the extruder at conditions sufficient to melt blend the PEG composite and the polymer composition. The PEG composite can comprise or consist essentially of PEG (preferably PEG having weight average molecular weight less than 10,000 g/mol) and one or polymers having melting point at 1 atm greater than that of the PEG.

Classes IPC  ?

• C08L 71/02 - Oxydes des polyalkylènes
• C08L 23/08 - Copolymères de l'éthylène

Abrégé

Alkylated naphthalene blendstock and processes for making the alkylated naphthalene blendstock are provided. The present processes comprise mixing an acid-form MWW-type catalyst, naphthalene, and a solvent to provide a reaction mixture and adding linear alpha olefins to the reaction mixture after heating. The resulting AN blendstock has an isomer ratio of less than 45 wt% mono alkylated naphthalene and greater than 55 wt% multi-alkylated naphthalene and can be combined with polyalphaolefin base stock to provide a synthetic lubricant formulation produced without triflic catalyst and with less process steps.

Classes IPC  ?

• C10M 105/06 - Hydrocarbures définis aromatiques
• C10M 111/00 - Compositions lubrifiantes caractérisées en ce que le matériau de base est un mélange d'au moins deux composés couverts par plus d'un des groupes principaux , chacun de ces composés étant un composé essentiel
• C10M 177/00 - Méthodes particulières de préparation des compositions lubrifiantesModification chimique par post-traitement des constituants ou de la composition lubrifiante elle-même, non couverte par d'autres classes
• C07C 2/02 - Préparation d'hydrocarbures à partir d'hydrocarbures contenant un plus petit nombre d'atomes de carbone par addition d'hydrocarbures non saturés entre eux
• C10N 30/02 - Point d'écoulementIndice de viscosité
• C10N 30/00 - Propriétés physiques ou chimiques particulières améliorées par l'additif caractérisant la composition lubrifiante, p. ex. additifs multifonctionnels
• C10N 70/00 - Procédés particuliers de préparation
• B01J 8/00 - Procédés chimiques ou physiques en général, conduits en présence de fluides et de particules solidesAppareillage pour de tels procédés

Abrégé

A method for forming carbon nanotubes may include: volatilizing a metal in a plasma to form an active catalyst; flowing the active catalyst and a carbon source into a floating catalyst chemical vapor deposition reactor; and pyrolyzing at least a portion of the carbon source on the active catalyst in a pyrolysis zone of the floating catalyst chemical vapor deposition reactor to form carbon nanotubes on the active catalyst.

Classes IPC  ?

• C01B 32/162 - Préparation caractérisée par les catalyseurs
• C01B 32/158 - Nanotubes de carbone
• B01J 19/08 - Procédés utilisant l'application directe de l'énergie ondulatoire ou électrique, ou un rayonnement particulaireAppareils à cet usage

Abrégé

Alkylated naphthalene blendstock and processes for making the alkylated naphthalene blendstock are provided. The present processes comprise mixing an acid-form MWW-type catalyst, naphthalene, and a solvent to provide a reaction mixture and adding linear alpha olefins to the reaction mixture after heating. The resulting AN blendstock has an isomer ratio of less than 45 wt % mono alkylated naphthalene and greater than 55 wt % multi-alkylated naphthalene and can be combined with polyalphaolefin base stock to provide a synthetic lubricant formulation produced without triflic catalyst and with less process steps.

Classes IPC  ?

• C10M 105/06 - Hydrocarbures définis aromatiques
• B01J 29/70 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes de types caractérisés par leur structure spécifique non prévus dans les groupes
• C10M 177/00 - Méthodes particulières de préparation des compositions lubrifiantesModification chimique par post-traitement des constituants ou de la composition lubrifiante elle-même, non couverte par d'autres classes
• C10N 20/00 - Propriétés physiques particulières des constituants des compositions lubrifiantes
• C10N 20/02 - ViscositéIndice de viscosité
• C10N 20/06 - Particules de forme ou de dimensions particulières
• C10N 70/00 - Procédés particuliers de préparation

Abrégé

Zeolites, designated as EMM-70, characterized by a unique powder XRD pattern, methods of making the same, and uses thereof.

Classes IPC  ?

• B01J 29/70 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes de types caractérisés par leur structure spécifique non prévus dans les groupes
• B01J 35/00 - Catalyseurs caractérisés par leur forme ou leurs propriétés physiques, en général
• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique

Abrégé

A grouser for a track shoe, the grouser comprising a matrix material and a plurality of embedded inserts. The inserts are arranged in the matrix material to form one or more ice lugs. The inserts have a hardness greater than a hardness of the matrix material, such that use of the grouser on a track shoe will abrade the matrix material at a rate greater than a rate of abrasion of the insert material.

Classes IPC  ?

• B62D 55/26 - Éléments ou maillons en contact avec le sol

Abrégé

A process for preparing a cement composition comprising an isoolefin-alkylstyrene copolymer and substantially free of an alkylstyrene monomer is described herein. The process comprises reacting the isoolefin monomer with at least a portion of the alkylstyrene monomer in a diluent to form an isoolefin-alkylstyrene copolymer, replacing the diluent with a solvent, reacting a halogenic scavenger with the unreacted alkylstyrene monomer in an absence of a free radical initiator in order to form a halogenic alkylstyrene compound without altering the isoolefin-alkylstyrene copolymer, and removing the halogenic alkylstyrene compound from the slurry to form the cement composition substantially free of the alkylstyrene monomer. Also disclosed herein is a composition comprising an isoolefin-alkylstyrene copolymer and an alkylstyrene monomer comprising a concentration less than about 20 ppm.

Classes IPC  ?

• C09J 125/16 - Homopolymères ou copolymères de styrènes substitués par un radical alkyle
• C09J 125/18 - Homopolymères ou copolymères de monomères aromatiques contenant des éléments autres que le carbone et l'hydrogène

Abrégé

Methods including: measuring a mid and/or near Fourier-transform infrared (FTIR) and/or Raman spectrum of a hydrocarbon fluid; determining an estimated cold filter plugging point (CFPP) for the hydrocarbon fluid using a vibrational spectroscopy-CFPP correlation model; and treating the hydrocarbon fluid to cause a change in the estimated CFPP. In some cases, the treating of the hydrocarbon fluid comprises: adding a flow improver to the hydrocarbon fluid.

Classes IPC  ?

• G01N 21/3577 - CouleurPropriétés spectrales, c.-à-d. comparaison de l'effet du matériau sur la lumière pour plusieurs longueurs d'ondes ou plusieurs bandes de longueurs d'ondes différentes en recherchant l'effet relatif du matériau pour les longueurs d'ondes caractéristiques d'éléments ou de molécules spécifiques, p. ex. spectrométrie d'absorption atomique en utilisant la lumière infrarouge pour l'analyse de liquides, p. ex. l'eau polluée
• G01N 21/35 - CouleurPropriétés spectrales, c.-à-d. comparaison de l'effet du matériau sur la lumière pour plusieurs longueurs d'ondes ou plusieurs bandes de longueurs d'ondes différentes en recherchant l'effet relatif du matériau pour les longueurs d'ondes caractéristiques d'éléments ou de molécules spécifiques, p. ex. spectrométrie d'absorption atomique en utilisant la lumière infrarouge
• G01N 21/65 - Diffusion de Raman
• G01N 25/12 - Recherche ou analyse des matériaux par l'utilisation de moyens thermiques en recherchant les changements d'état ou de phaseRecherche ou analyse des matériaux par l'utilisation de moyens thermiques en recherchant le frittage du point critiqueRecherche ou analyse des matériaux par l'utilisation de moyens thermiques en recherchant les changements d'état ou de phaseRecherche ou analyse des matériaux par l'utilisation de moyens thermiques en recherchant le frittage d'un autre changement de phase
• G01N 33/28 - Huiles

Abrégé

A reactor useful in the production and conversion of hydrocarbon feedstocks may include: a pressure vessel with an interior wall; a refractory lining inside the reactor, wherein the refractory lining comprises: a first layer comprising a brick refractory, a second layer comprising a refractory castable, wherein the refractory castable comprises an aggregate and a binder, wherein the binder comprises CaO·6Al2O3 and less than 1 wt % of a hydratable calcium aluminate, and a third layer comprising a fiber refractory, wherein the second layer is between the first and third layers, and wherein the third layer is closest to the interior wall.

Classes IPC  ?

• C04B 35/10 - Produits céramiques mis en forme, caractérisés par leur compositionCompositions céramiquesTraitement de poudres de composés inorganiques préalablement à la fabrication de produits céramiques à base d'oxydes à base d'oxyde d'aluminium
• B01J 6/00 - CalcinationCuisson
• C01B 3/02 - Production d'hydrogène ou de mélanges gazeux contenant de l'hydrogène
• C10J 3/78 - Appareils à haute pression

Abrégé

The present disclosure provides a process that includes providing bitumen; performing thermal upgrading on the bitumen to form mildly upgraded bitumen; distilling the mildly upgraded bitumen to form streams of naphtha; distillates and/or gas oils; and residue; combining the naphtha and residue to form a naphtha/residue stream, which causes deasphalting to occur, and forming streams of deasphalted oil and high-carbon pitch comprising asphaltenes; and adding the distillates and/or gas oils to the deasphalted oil to form partially upgraded bitumen.

Classes IPC  ?

• C10C 3/00 - Traitement du brai, de l'asphalte, du bitume
• C10C 3/06 - Traitement du brai, de l'asphalte, du bitume par distillation

Abrégé

4-++++++++4-4- olefinicity of about 80% or more.

Classes IPC  ?

• C10G 11/05 - Alumino-silicates cristallins, p. ex. tamis moléculaires
• B01J 29/08 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes du type faujasite, p. ex. du type X ou Y
• B01J 29/70 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes de types caractérisés par leur structure spécifique non prévus dans les groupes
• B01J 29/80 - Mélanges de différentes zéolites
• B01J 37/00 - Procédés de préparation des catalyseurs, en généralProcédés d'activation des catalyseurs, en général
• C10G 11/18 - Craquage catalytique, en l'absence d'hydrogène, des huiles d'hydrocarbures avec catalyseurs solides mobiles préchauffés selon la technique du "lit fluidisé"

Abrégé

233 and less than 1 wt% of a hydratable calcium aluminate, and a third layer comprising a fiber refractory, wherein the second layer is between the first and third layers, and wherein the third layer is closest to the interior wall.

Classes IPC  ?

• B01J 19/02 - Appareils caractérisés par le fait qu'ils sont construits avec des matériaux choisis pour leurs propriétés de résistance aux agents chimiques

Abrégé

Systems and methods are provided for performing amine capture on a heated flue gas using multiple rotating packed beds. By integrating a series of rotating packed beds to perform cooling of the flue gas, removal of CO2 from the flue gas by contact with an aqueous amine, and washing of the gaseous effluent from CO2 removal step to remove any entrained amine, the equipment footprint and overall equipment volume required for CO2 capture can be significantly reduced. The integration of cooling, CO2 removal, and washing can be integrated into a series of packed beds in part by using different packing materials in the various packed beds.

Classes IPC  ?

• B01D 53/18 - Unités d'absorptionDistributeurs de liquides
• B01D 53/14 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par absorption
• B01D 53/62 - Oxydes de carbone
• B01D 53/78 - Procédés en phase liquide avec un contact gaz-liquide

Abrégé

In various aspects, molten carbonate fuel cell configurations are provided that include a reforming catalyst and alkali traps integrated with one or more structures within the anode gas-collection volume. The purpose of the reforming catalyst is to reform methane (or some other reformable fuel) into hydrogen. In operation, alkali metals may migrate from the fuel cell electrolyte into the anode. Unless trapped, the alkali metals may deactivate the reforming catalyst. The alkali trap prolongs the operating life of reforming catalyst within the anode volume by capturing some portion of the alkali metal in the anode gas-collection volume. This reduces an amount of alkali metal that interacts with the reforming catalyst in the anode gas-collection volume. The prolonged life of the reforming catalyst prevents a decrease in catalyst activity.

Classes IPC  ?

• H01M 8/14 - Éléments à combustible avec électrolytes fondus
• H01M 8/0612 - Combinaison d’éléments à combustible avec des moyens de production de réactifs ou pour le traitement de résidus avec des moyens de production des réactifs gazeux à partir de matériaux contenant du carbone

Abrégé

A method including: introducing a feed comprising an alcohol and an activator into a reactor comprising a solid acid catalyst; contacting the alcohol and the activator in the presence of the solid acid catalyst under conditions effective to convert at least a portion of the alcohol and the activator to produce a product stream comprising C8-C16 olefins and water; thermally contacting at least a portion of the C8-C16 olefins and/or water with a working fluid to heat the working fluid to form a heated working fluid; and introducing at least a portion of the C8-C16 olefins and water from the product stream into a distillation column and forming a bottoms stream comprising a majority of the C8-C16 olefins from the product stream, wherein a reboiler thermally coupled to the distillation column is at least partially heated by the heated working fluid.

Classes IPC  ?

• C10G 3/00 - Production de mélanges liquides d'hydrocarbures à partir de matières organiques contenant de l'oxygène, p. ex. huiles, acides gras
• C10G 7/04 - Déshydratation

Abrégé

This application relates to catalyst systems, methods, and compositions, and more particularly, to catalyst systems, methods, and compositions for cationic polymerization of norbornenes. Compositions include catalytic polymerization reaction product of 5-Ethylidene-2-norbornene (ENB) monomers; a catalyst trimethylsilylchloride; a co-catalyst of lithium tetrakis(pentafluorophenyl) borate ethyl etherate; and an optional polar solvent, thereby producing a 5-Ethylidene-2-norbornene polymer (polyENB).

Classes IPC  ?

• C08F 136/20 - Homopolymères de composés possédant un ou plusieurs radicaux aliphatiques non saturés, l'un au moins contenant plusieurs liaisons doubles carbone-carbone le radical ne contenant que deux doubles liaisons carbone-carbone non conjuguées
• C08F 4/58 - MétauxHydrures métalliquesComposés organiques de métalLeur utilisation comme précurseurs de catalyseurs choisis parmi les métaux légers, le zinc, le cadmium, le mercure, le cuivre, l'argent, l'or, le bore, le gallium, l'indium, le thallium, les terres rares ou les actinides en mélange avec du silicium, du germanium, de l'étain, du plomb, de l'antimoine, du bismuth ou leurs composés

Abrégé

The present disclosure relates to gas impermeable, self-healing, and self-sealing elastomeric compositions and methods thereof. In at least one embodiment, an elastomer composition comprises a first elastomer and a second elastomer, wherein the first elastomer is a copolymer comprising p-methlystyrene. p-halomethylstyrene, and isobutylene derived repeat units and comprises about 30 phr to about 100 phr of the elastomeric composition. In at least one embodiment, an elastomeric network includes a first elastomer, a second elastomer, and a nucleophilic compound, wherein the nucleophilic compound is a crosslinking agent and comprises about 1.4 phr to about 2.7 phr of the elastomeric compostion. In some embodiments, a method comprises mixing a first elastomer and a second elastomer to form an elastomer composition, blending the elastomer composition with a nucleophilic compound to form an elastomeric network, and integrating the elastomeric network into an outer rubber sidewall layer of a tire.

Classes IPC  ?

• C08L 23/28 - Compositions contenant des homopolymères ou des copolymères d'hydrocarbures aliphatiques non saturés ne possédant qu'une seule liaison double carbone-carboneCompositions contenant des dérivés de tels polymères modifiées par post-traitement chimique par réaction avec les halogènes ou des composés contenant des halogènes
• B60C 1/00 - Pneumatiques caractérisés par la composition chimique, la disposition ou le mélange physique de la composition

Abrégé

22222 removal, and washing can be integrated into a series of packed beds in part by using different packing materials in the various packed beds.

Classes IPC  ?

• B01D 53/14 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par absorption
• B01D 53/62 - Oxydes de carbone
• B01D 53/75 - Procédés multi-étapes
• B01D 53/78 - Procédés en phase liquide avec un contact gaz-liquide
• F28C 3/06 - Autres appareils échangeurs de chaleur à contact direct les sources de potentiel calorifique étant un liquide et un gaz ou une vapeur

Abrégé

816 816 816 16 olefins in the hydrocarbon rich stream.

Classes IPC  ?

• C10G 3/00 - Production de mélanges liquides d'hydrocarbures à partir de matières organiques contenant de l'oxygène, p. ex. huiles, acides gras
• C07C 1/24 - Préparation d'hydrocarbures à partir d'un ou plusieurs composés, aucun d'eux n'étant un hydrocarbure à partir de composés organiques ne renfermant que des atomes d'oxygène en tant qu'hétéro-atomes par élimination d'eau

Abrégé

61616.

Classes IPC  ?

• C10G 3/00 - Production de mélanges liquides d'hydrocarbures à partir de matières organiques contenant de l'oxygène, p. ex. huiles, acides gras
• C07C 1/24 - Préparation d'hydrocarbures à partir d'un ou plusieurs composés, aucun d'eux n'étant un hydrocarbure à partir de composés organiques ne renfermant que des atomes d'oxygène en tant qu'hétéro-atomes par élimination d'eau

Abrégé

616 16 olefins.

Classes IPC  ?

• C10G 3/00 - Production de mélanges liquides d'hydrocarbures à partir de matières organiques contenant de l'oxygène, p. ex. huiles, acides gras
• C07C 1/20 - Préparation d'hydrocarbures à partir d'un ou plusieurs composés, aucun d'eux n'étant un hydrocarbure à partir de composés organiques ne renfermant que des atomes d'oxygène en tant qu'hétéro-atomes
• C07C 11/02 - Alcènes

Abrégé

The present disclosure provides methods and systems for converting ethanol and cracking hydrocarbons into ethylene and at least cracked products. A method to convert ethanol and cracking hydrocarbons includes: introducing a hydrocarbon feed into a riser of a fluid catalytic cracking reactor such that hydrocarbons in the hydrocarbon feed reacts in the presence of one or more fluid catalytic cracking catalysts to produce at least cracked products; and introducing an ethanol feed into an upper one third of a stripper of the fluid catalytic cracking reactor such that the ethanol reacts in the presence of spent catalyst flowing downwardly from a separator section of the fluid catalytic cracking reactor to produce at least ethylene.

Classes IPC  ?

• C10G 11/05 - Alumino-silicates cristallins, p. ex. tamis moléculaires
• C07C 1/24 - Préparation d'hydrocarbures à partir d'un ou plusieurs composés, aucun d'eux n'étant un hydrocarbure à partir de composés organiques ne renfermant que des atomes d'oxygène en tant qu'hétéro-atomes par élimination d'eau
• C10G 11/18 - Craquage catalytique, en l'absence d'hydrogène, des huiles d'hydrocarbures avec catalyseurs solides mobiles préchauffés selon la technique du "lit fluidisé"

Abrégé

The present disclosure provides methods and systems for converting ethanol and cracking hydrocarbons into ethylene and at least cracked products. A method to convert ethanol and cracking hydrocarbons includes: introducing a hydrocarbon feed into a riser of a fluid catalytic cracking reactor such that hydrocarbons in the hydrocarbon feed reacts in the presence of one or more fluid catalytic cracking catalysts to produce at least cracked products; and introducing an ethanol feed into an upper one third of a stripper of the fluid catalytic cracking reactor such that the ethanol reacts in the presence of spent catalyst flowing downwardly from a separator section of the fluid catalytic cracking reactor to produce at least ethylene.

Classes IPC  ?

• C10G 3/00 - Production de mélanges liquides d'hydrocarbures à partir de matières organiques contenant de l'oxygène, p. ex. huiles, acides gras
• C07C 11/04 - Éthylène
• C10G 11/18 - Craquage catalytique, en l'absence d'hydrogène, des huiles d'hydrocarbures avec catalyseurs solides mobiles préchauffés selon la technique du "lit fluidisé"
• C10G 51/06 - Traitement des huiles d'hydrocarbures, en l'absence d'hydrogène, uniquement par plusieurs procédés de craquage uniquement par plusieurs étapes en parallèle

Abrégé

In various aspects, molten carbonate fuel cell configurations are provided that include a reforming catalyst (124) and alkali traps (122) integrated with one or more structures within the anode gas-collection volume. The purpose of the reforming catalyst (124) is to reform methane (or some other reformable fuel) into hydrogen. In operation, alkali metals may migrate from the fuel cell electrolyte into the anode. Unless trapped, the alkali metals may deactivate the reforming catalyst. The alkali trap (122) prolongs the operating life of reforming catalyst (124) within the anode volume by capturing some portion of the alkali metal in the anode gas-collection volume. This reduces an amount of alkali metal that interacts with the reforming catalyst (124) in the anode gas-collection volume. The prolonged life of the reforming catalyst prevents a decrease in catalyst activity.

Classes IPC  ?

• H01M 8/0247 - CollecteursSéparateurs, p. ex. séparateurs bipolairesInterconnecteurs caractérisés par la forme
• H01M 8/0612 - Combinaison d’éléments à combustible avec des moyens de production de réactifs ou pour le traitement de résidus avec des moyens de production des réactifs gazeux à partir de matériaux contenant du carbone
• H01M 8/0637 - Reformage interne direct à l’anode de l’élément à combustible
• H01M 8/0662 - Traitement des réactifs gazeux ou des résidus gazeux, p. ex. nettoyage
• H01M 8/14 - Éléments à combustible avec électrolytes fondus

Abrégé

616 61661661616 paraffins.

Classes IPC  ?

• C10G 3/00 - Production de mélanges liquides d'hydrocarbures à partir de matières organiques contenant de l'oxygène, p. ex. huiles, acides gras
• C07C 11/02 - Alcènes
• C10G 45/32 - Hydrogénation sélective des composés dioléfiniques ou acétyléniques

Abrégé

22222222 2 222 stream.

Classes IPC  ?

• B01D 53/14 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par absorption

Abrégé

Systems and methods are provided for integrating paraffinic froth treatment of oil sands for bitumen production with subsequent slurry hydroprocessing for formation of a heavy hydrocarbon product that can satisfy transport specifications, such as pipeline transport specifications. The integrated systems and methods can allow for increased retention of hydrocarbons, such as asphaltenes, in the bitumen and/or in the resulting heavy hydrocarbon product. This increase in hydrocarbon retention is achieved, at least in part, by modifying the severity of the paraffinic froth treatment to form the bitumen.

Classes IPC  ?

• C10G 1/00 - Production de mélanges liquides d'hydrocarbures à partir de schiste bitumineux, de sable pétrolifère ou de matières carbonées solides non fusibles ou similaires, p. ex. bois, charbon
• C10G 1/04 - Production de mélanges liquides d'hydrocarbures à partir de schiste bitumineux, de sable pétrolifère ou de matières carbonées solides non fusibles ou similaires, p. ex. bois, charbon par extraction
• C10G 47/26 - Craquage des huiles d'hydrocarbures, en présence d'hydrogène ou de composés donneurs d'hydrogène, pour obtenir des fractions à point d'ébullition inférieur avec des particules solides en mouvement en suspension dans de l'huile, p. ex. sous forme de bouillie
• C10G 67/04 - Traitement des huiles d'hydrocarbures, uniquement par au moins un procédé d'hydrotraitement et au moins un procédé de raffinage en l'absence d'hydrogène uniquement par plusieurs étapes en série comprenant une extraction par solvant comme étape de raffinage en l'absence d'hydrogène

Abrégé

22222xx22 and recycled to the regenerator.

Classes IPC  ?

• C10G 11/18 - Craquage catalytique, en l'absence d'hydrogène, des huiles d'hydrocarbures avec catalyseurs solides mobiles préchauffés selon la technique du "lit fluidisé"

Abrégé

21.62.12.1) in the range of 18 to 100, whereby at least one TREF peak is a major fraction that accounts for at least 90 wt% of the copolymer and at least one TREF peak is a minor fraction that accounts for less than 8 wt% of the copolymer and is found in the range of 60°C to 95°C. The ethylene copolymer has excellent pellet stability with minimal or no anti-blocking agents needed, and can be used in blown film, elastic and auto TPO applications.

Classes IPC  ?

• C08F 210/16 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP
• C08F 4/659 - Composant couvert par le groupe contenant une liaison métal de transition-carbone

Abrégé

In various aspects, systems and methods are provided for operating an oxygen-fired catalyst regenerator with flue gas recycle and CO2 capture. An oxygen-fired catalyst regenerator contrasts with an air-fired regenerator. The oxygen-fired catalyst regenerator substantially reduces nitrogen within the system, which facilitates CO2 capture by reducing the energy required to capture CO2. In various aspects, a first portion of the regenerator flue gas is passed to a CO2 capture system and a second portion is recycled to the regenerator. Before the flue gas is recycled or diverted to the CO2 capture, it is passed to various processes that remove and/or reduce SOx, NOx, particulate, and water content. In various aspects, a portion of the treated flue gas may be combined with substantially pure O2 and recycled to the regenerator.

Classes IPC  ?

• C10G 11/05 - Alumino-silicates cristallins, p. ex. tamis moléculaires
• B01D 47/10 - Épurateurs à Venturi
• B01D 53/14 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par absorption
• B01D 53/75 - Procédés multi-étapes
• B01D 53/86 - Procédés catalytiques
• B01J 38/14 - Traitement avec un gaz contenant de l'oxygène libre en réglant la teneur en oxygène dans le gaz d'oxydation
• B03C 3/017 - Combinaison de la séparation par effet électrostatique avec d'autres procédés, non prévue ailleurs
• B03C 3/16 - Installations alimentées en électricité de l'extérieur du type par voie humide

Abrégé

Processes for making olefin copolymers, particularly ethylene-based copolymers. A process for making an olefin copolymer can include introducing an olefin monomer, at least one other olefin comonomer, and a single type of catalyst system to a tubular reactor to produce an olefin copolymer containing: a) an absolute comonomer distribution (CD) slope 90 of about 2.0 to about 30.0, an absolute CD slope 75 of about 2.0 to about 30.0, an absolute CD slope 50 of about 2.0 to about 30.0, or an absolute CD slope 25 of about 2.0 to about 30.0; b) a first long chain branching index (g′(Mz)) of about 0.30 to about 1.0; and c) a second long chain branching index (g′(Mz+1)) of about 0.30 to about 1.0. The tubular reactor can include one or more plug flow components, one or more spiral heat exchangers, and/or a recycle pump.

Classes IPC  ?

• C08F 2/01 - Procédés de polymérisation caractérisés par des éléments particuliers des appareils de polymérisation utilisés
• C08F 4/659 - Composant couvert par le groupe contenant une liaison métal de transition-carbone

Abrégé

Amorphous silica-alumina support materials are provided that can serve as supports for polyamines. The silica-alumina support materials have a combination of properties that unexpectedly allow supported polyamines to retain an increased or maximized amount of CO2 sorption capacity after incorporation of substantial amounts of the polyamine on the support material. This combination of properties can include having a high pore volume, a high ratio of mesopore volume to micropore volume, and a sufficiently high acidity. The ability to allow supported amine sorbents to retain additional CO2 sorption capacity is unexpected. Additionally, the relationship between having sufficiently high acidity and providing improved sorption capacity for a supported amine material is unexpected.

Classes IPC  ?

• B01J 20/26 - Composés macromoléculaires synthétiques
• B01J 20/32 - Imprégnation ou revêtement

Abrégé

222 sorption capacity for the resulting supported modified polyamine material.

Abrégé

222 sorption capacity is unexpected. Conventionally, even when high pore volume support materials are used to support an amine sorbent, only a limited amount of the amine sorbent can be supported on the support material before substantial losses of sorbent capacity occur relative to the amount of amine sorbent.

Classes IPC  ?

• B01J 20/12 - Argiles d'origine naturelle ou terres décolorantes
• B01D 53/02 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse
• B01D 53/62 - Oxydes de carbone
• B01J 20/18 - Tamis moléculaires zéolitiques synthétiques
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques
• B01J 20/32 - Imprégnation ou revêtement

Abrégé

Monolith structures coated with porous solids are provided that can serve as structural materials for amine sorbents, such as polyamine sorbents. By using monolith structures that are coated with suitable porous solids, the sorption capacity of an amine sorbent material that is deposited on the monolith coated with the porous solid can be substantially maintained as the loading density of the amine is increased. This can allow for higher productivity sorption systems by allowing higher concentrations of amine to be effectively used while still substantially maintaining the favorable sorption characteristics of the amine sorbent.

Classes IPC  ?

• B01J 20/12 - Argiles d'origine naturelle ou terres décolorantes
• B01D 53/02 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse
• B01D 53/62 - Oxydes de carbone
• B01J 20/18 - Tamis moléculaires zéolitiques synthétiques
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques
• B01J 20/32 - Imprégnation ou revêtement
• B01J 20/16 - Alumino-silicates
• B01J 20/08 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance inorganique contenant des oxydes ou des hydroxydes des métaux non prévus dans le groupe contenant de l'oxyde ou de l'hydroxyde d'aluminiumCompositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance inorganique contenant des oxydes ou des hydroxydes des métaux non prévus dans le groupe contenant de la bauxite
• B01J 20/10 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance inorganique contenant de la silice ou un silicate

Abrégé

222 sorption capacity is unexpected. Additionally, the relationship between having sufficiently high acidity and providing improved sorption capacity for a supported amine material is unexpected.

Classes IPC  ?

• B01J 20/08 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance inorganique contenant des oxydes ou des hydroxydes des métaux non prévus dans le groupe contenant de l'oxyde ou de l'hydroxyde d'aluminiumCompositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance inorganique contenant des oxydes ou des hydroxydes des métaux non prévus dans le groupe contenant de la bauxite
• B01J 20/10 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance inorganique contenant de la silice ou un silicate
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques
• B01J 20/32 - Imprégnation ou revêtement
• B01D 53/02 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse
• B01D 53/62 - Oxydes de carbone

Abrégé

Crystalline support materials are provided that can serve as supports for polyamines. The support materials have a combination of properties that unexpectedly allows supported polyamines to retain an increased or maximized amount of CO2 sorption capacity after incorporation of substantial amounts of the polyamine on the support material. This combination of properties can include having a high pore volume, a high ratio of mesopore volume to micropore volume, and a sufficiently high acidity. The ability to allow supported amine sorbents to retain additional CO2 sorption capacity is unexpected. Conventionally, even when high pore volume support materials are used to support an amine sorbent, only a limited amount of the amine sorbent can be supported on the support material before substantial losses of sorbent capacity occur relative to the amount of amine sorbent.

Classes IPC  ?

• B01J 20/26 - Composés macromoléculaires synthétiques
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques

Abrégé

Monolith structures coated with porous solids are provided that can serve as structural materials for amine sorbents, such as polyamine sorbents. By using monolith structures that are coated with suitable porous solids, the sorption capacity of an amine sorbent material that is deposited on the monolith coated with the porous solid can be substantially maintained as the loading density of the amine is increased. This can allow for higher productivity sorption systems by allowing higher concentrations of amine to be effectively used while still substantially maintaining the favorable sorption characteristics of the amine sorbent.

Classes IPC  ?

• B01J 20/32 - Imprégnation ou revêtement
• B01J 20/26 - Composés macromoléculaires synthétiques

Abrégé

Propylene-based elastomer compositions that include a blend of a majority polymer fraction having a higher Mw and a minority polymer fraction having a lower Mw, methods of making same, and hot melt adhesives including such compositions. The polymer blend compositions can include: a major polymer fraction having a Mw of about 100,000 to about 300,000 and a melt flow rate of about 0.1 g/10 min to about 70.0 g/10 min, according to ASTM D1238; and a minor polymer fraction having a Mw of about 5,000 to about 60,000 and a Brookfield viscosity of about 500 cP to about 50,000 cP, according to ASTM D-3236 (190° C.), wherein an amount of the at least one other polyolefin comonomer in the minor polymer fraction is at least 7 wt % less than an amount of the at least one other polyolefin comonomer in the major polymer fraction.

Classes IPC  ?

• C08L 23/16 - Copolymères de l’éthylène et du propylène ou de l’éthylène, du propylène et de diène
• C09J 7/32 - Adhésifs sous forme de films ou de pellicules caractérisés par la composition de l’adhésif activés au contact de l’eau, p. ex. pour papier gommé
• C09J 123/16 - Copolymères éthylène-propène ou éthylène-propène-diène

Abrégé

Compositions are provided that include at least a portion of an isoparaffinic blend component, an iso-olefinic blend component, or a combination thereof, along with a method for making such a blend component. The highly isoparaffinic and/or iso-olefinic nature of the blend component can allow a blend component to be used in combination with both conventional/mineral fractions as well as non-traditional feeds to form fuel fractions and/or fuel blending component fractions. Examples of fuels that can be formed by making a blend that includes an isoparaffinic and/or iso-olefinic blend component include diesel fuels, marine gas oils, and various types of marine fuel oils, such as very low sulfur fuel oils.

Classes IPC  ?

• C10L 1/08 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures pour allumage par compression

Abrégé

Jet boiling range compositions are provided that include at least a portion of an isoparaffinic blend component, along with a method for making such a blend component. The highly isoparaffinic nature of the blend component can allow the isoparaffinic blend component to be used in combination with both conventional/mineral jet fuel boiling range fractions as well as non-traditional feeds (such as Fischer-Tropsch fractions) to form jet fuel fractions and/or jet fuel blending component fractions.

Classes IPC  ?

• C10L 1/08 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures pour allumage par compression

Abrégé

Palladium-based catalyst systems are provided for reforming of hydrocarbons, along with methods for using such catalyst systems. The catalyst systems can be deposited or otherwise coated on a surface or structure, such as a monolith, to achieve improved activity and/or structural stability. It has been discovered that loss of catalytic activity for reforming over time can be reduced or minimized for palladium-based catalyst system by operating the reactor/performing a reaction cycle so that the portion of the reaction environment containing the palladium-based catalyst system is not exposed to oxidizing conditions at temperatures between 600° C. and 900° C. Optionally, the reactor can also be operated/the reaction cycle can also be designed so that during a reforming cycle, the peak temperature in the portion of the reaction environment containing the palladium-based catalyst system is 1300° C. or less.

Classes IPC  ?

• B01J 35/00 - Catalyseurs caractérisés par leur forme ou leurs propriétés physiques, en général
• B01J 21/04 - Alumine
• B01J 23/44 - Palladium
• B01J 23/46 - Ruthénium, rhodium, osmium ou iridium
• B01J 23/755 - Nickel
• B01J 23/96 - Régénération ou réactivation de catalyseurs contenant des métaux, oxydes ou hydroxydes des métaux nobles
• B01J 35/57 - Nids d’abeilles
• B01J 37/00 - Procédés de préparation des catalyseurs, en généralProcédés d'activation des catalyseurs, en général
• B01J 38/12 - Traitement avec un gaz contenant de l'oxygène libre
• C01B 3/40 - Production d'hydrogène ou de mélanges gazeux contenant de l'hydrogène par réaction de composés organiques gazeux ou liquides avec des agents gazéifiants, p. ex. de l'eau, du gaz carbonique, de l'air par réaction d'hydrocarbures avec des agents gazéifiants avec des catalyseurs caractérisée par le catalyseur

Abrégé

This disclosure relates to EMM-41 materials, methods for making it, and processes for its use. This disclosure also relates to the structure directing agents used in the methods for making the EMM-41 material as well as the synthesis method used to prepare such structure directing agents.

Classes IPC  ?

• B01J 20/18 - Tamis moléculaires zéolitiques synthétiques
• B01D 53/02 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques
• B01J 20/30 - Procédés de préparation, de régénération ou de réactivation
• C01B 39/46 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie
• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique
• C07D 207/06 - Composés hétérocycliques contenant des cycles à cinq chaînons, non condensés avec d'autres cycles, ne comportant qu'un atome d'azote comme unique hétéro-atome du cycle avec uniquement des atomes d'hydrogène ou de carbone liés directement à l'atome d'azote du cycle ne comportant pas de liaison double entre chaînons cycliques ou entre chaînons cycliques et chaînons non cycliques avec des radicaux contenant uniquement des atomes d'hydrogène et de carbone, liés aux atomes de carbone du cycle
• C10G 25/03 - Raffinage des huiles d'hydrocarbures, en l'absence d'hydrogène, au moyen d'absorbants ou d'adsorbants solides avec échangeur d'ions avec des alumino-silicates cristallins, p. ex. avec des tamis moléculaires

Abrégé

Compositions are provided that include at least a portion of an isoparaffinic blend component, an iso-olefinic blend component, or a combination thereof, along with a method for making such a blend component. The highly isoparaffinic and/or iso-olefinic nature of the blend component can allow a blend component to be used in combination with both conventional/mineral fractions as well as non-traditional feeds to form fuel fractions and/or fuel blending component fractions. Examples of fuels that can be formed by making a blend that includes an isoparaffinic and/or iso-olefinic blend component include diesel fuels, marine gas oils, and various types of marine fuel oils, such as very low sulfur fuel oils.

Classes IPC  ?

• C10L 1/04 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures

Abrégé

Jet boiling range compositions are provided that include at least a portion of an isoparaffinic blend component, along with a method for making such a blend component. The highly isoparaffinic nature of the blend component can allow the isoparaffinic blend component to be used in combination with both conventional/mineral jet fuel boiling range fractions as well as non-traditional feeds (such as Fischer-Tropsch fractions) to form jet fuel fractions and/or jet fuel blending component fractions.

Classes IPC  ?

• C10L 1/04 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures
• C10L 1/16 - Hydrocarbures

Abrégé

This disclosure relates to EMM-41 materials, methods for making it, and processes for its use. This disclosure also relates to the structure directing agents used in the methods for making the EMM-41 material as well as the synthesis method used to prepare such structure directing agents.

Classes IPC  ?

• B01J 20/18 - Tamis moléculaires zéolitiques synthétiques
• B01D 53/02 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques
• B01J 20/30 - Procédés de préparation, de régénération ou de réactivation
• C01B 39/46 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie
• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique
• C07D 207/06 - Composés hétérocycliques contenant des cycles à cinq chaînons, non condensés avec d'autres cycles, ne comportant qu'un atome d'azote comme unique hétéro-atome du cycle avec uniquement des atomes d'hydrogène ou de carbone liés directement à l'atome d'azote du cycle ne comportant pas de liaison double entre chaînons cycliques ou entre chaînons cycliques et chaînons non cycliques avec des radicaux contenant uniquement des atomes d'hydrogène et de carbone, liés aux atomes de carbone du cycle
• C10G 25/03 - Raffinage des huiles d'hydrocarbures, en l'absence d'hydrogène, au moyen d'absorbants ou d'adsorbants solides avec échangeur d'ions avec des alumino-silicates cristallins, p. ex. avec des tamis moléculaires

Abrégé

An embodiment of the present disclosure provides an isolated nucleic acid molecule comprising a sequence encoding a protein having a PhaP1 domain and a HlyA domain, wherein the HlyA domain differs from the wild-type HlyA domain of E. coli (SEQ ID NO.: 1) An embodiment of the present disclosure provides an isolated nucleic acid molecule comprising a sequence encoding a protein having a PhaP1 domain and a HlyA domain, wherein the HlyA domain differs from the wild-type HlyA domain of E. coli (SEQ ID NO.: 1) SEQ ID NO. 1: LAYGSQGDLNPLINEISKIISAAGSFDVKEERTAAS LLQLSGNASDFSYGRNSITLTTSA in at least the wild-type amino acid residue S (serine) at position 25 (underlined above) is replaced with the amino acid residue N (asparagine).

Classes IPC  ?

• C12P 7/625 - Polyesters d'acides hydroxycarboxyliques
• C07K 14/195 - Peptides ayant plus de 20 amino-acidesGastrinesSomatostatinesMélanotropinesLeurs dérivés provenant de bactéries
• C07K 14/245 - Escherichia (G)
• C12N 15/70 - Vecteurs ou systèmes d'expression spécialement adaptés à E. coli

Abrégé

Disclosed embodiments may include a material having a composition including a mesophase pitch material between approximately 5.0% to 95.0% and having a viscosity of between approximately 0.01 to 102s ≤ 475 oss ≥ 150 oC. At least a portion of the mesophase pitch material may be aligned by a magnetic field having a strength of approximately 0.25 to 6.0 Tesla. The portion of the mesophase pitch material may have an average molecular spacing of between approximately 3.4 to 3.7 angstroms, and an average molecular size of between approximately 1 to 3 nanometers (nm).

Classes IPC  ?

• C09K 19/02 - Substances formant des cristaux liquides caractérisées par les propriétés optiques, électriques ou physiques des constituants, en général
• C09K 19/04 - Substances formant des cristaux liquides caractérisées par la structure chimique des constituants formant des cristaux liquides
• D01F 9/145 - Filaments de carboneAppareils spécialement adaptés à leur fabrication par décomposition de filaments organiques à partir de brai ou de résidus de distillation
• D01F 9/32 - Appareils à cet effet
• G02F 1/1337 - Orientation des molécules des cristaux liquides induite par les caractéristiques de surface, p. ex. par des couches d'alignement
• C01B 32/15 - Matières carbonées nanométriques
• C10C 3/02 - Traitement du brai, de l'asphalte, du bitume par des moyens chimiques

Abrégé

Asphalt compositions are provided that correspond to blends of lubricating oil base stocks with deasphalter residue. It has unexpectedly been found that lubricating oil base stock can be blended with deasphalter residue to form asphalts that can satisfy the specification for various types of paving and/or roofing asphalts. As a result, lubricating oils can be used as a blend stock for uplift of deasphalter residue to asphalt while reducing, minimizing, or even eliminating the need to blend the deasphalter residue with a conventional vacuum distillation bottoms fraction.

Classes IPC  ?

• C08L 95/00 - Compositions contenant des matières bitumeuses, p. ex. asphalte, goudron ou brai
• C08L 91/00 - Compositions contenant des huiles, graisses ou ciresCompositions contenant leurs dérivés
• C10G 53/06 - Traitement des huiles d'hydrocarbures, en l'absence d'hydrogène, par plusieurs procédés de raffinage uniquement par plusieurs étapes en série comprenant au moins une étape d'extraction ne comprenant que des étapes d'extraction, p. ex. désasphaltage par un solvant suivi d'une extraction des composés aromatiques

Abrégé

Rubber blends may comprise at least one rubber compound, and at least one wax mixed with the at least one rubber compound, and wherein the at least one wax comprises an unsaturated wax. Suitable unsaturated waxes may include, but are not limited to C18+ linear alpha olefins (LAOs), LAO dimers formed from C18+ LAOs and having an internal olefin, or any combination thereof. The C18+ LAOs may be C20-C24 LAOs or C24+ LAOs. The rubber blends may be used in forming various rubber articles and in forming at least a portion of a tire, such as a tire sidewall containing a vulcanized rubber blend.

Classes IPC  ?

• C08L 9/00 - Compositions contenant des homopolymères ou des copolymères d'hydrocarbures à diènes conjugués
• B60C 1/00 - Pneumatiques caractérisés par la composition chimique, la disposition ou le mélange physique de la composition
• C08L 7/00 - Compositions contenant du caoutchouc naturel

Abrégé

Processes comprising: heat treating a heavy hydrocarbon feedstock in a heat treatment unit to produce a first effluent comprising a heat treated product; at least partially removing a mixture of gas and distillate from the first effluent in a first separation unit to produce a second effluent comprising a separation bottom product; deasphalting the second effluent in a second separation unit in the presence of a first solvent to produce: a soluble product fraction comprising a first portion of the first solvent, a deasphalted oil (DAO) product, and a first pitch product; an insoluble product fraction comprising a second portion of the first solvent and a portion of the first pitch product; and at least partially removing the second portion of the first solvent from the first pitch product in a third separation unit to produce a purified pitch product.

Classes IPC  ?

• C10C 3/08 - Traitement du brai, de l'asphalte, du bitume par extraction sélective
• C10C 3/00 - Traitement du brai, de l'asphalte, du bitume
• C10G 21/00 - Raffinage des huiles d'hydrocarbures, en l'absence d'hydrogène, par extraction au moyen de solvants sélectifs

Abrégé

A method involves propagating hydraulic fractures in a reservoir. Such method includes creating a low pressure region in an attractor well. The attractor well is proximate to an area in which hydraulic fractures are desired. The method also includes initiating a hydraulic fracturing operation at a treatment well. The hydraulic fracturing operation is initiated so that a fracture network created by the hydraulic fracturing operation is drawn to propagate toward the low pressure region of the attractor well.

Classes IPC  ?

• E21B 43/26 - Procédés pour activer la production par formation de crevasses ou de fractures
• E21B 43/30 - Disposition particulière des puits, p. ex. disposition rendant optimum l'espacement des puits

Abrégé

222222-containing gas to produce a regenerated and reduced catalyst.

Classes IPC  ?

• B01J 21/04 - Alumine
• B01J 21/10 - MagnésiumSes oxydes ou hydroxydes
• B01J 23/14 - Catalyseurs contenant des métaux, oxydes ou hydroxydes métalliques non prévus dans le groupe du germanium, de l'étain ou du plomb
• B01J 23/42 - Platine
• B01J 38/02 - Traitement thermique
• B01J 38/06 - Traitement avec un gaz ou une vapeurTraitement avec des liquides vaporisables au contact du catalyseur épuisé avec de la vapeur d'eau
• B01J 38/10 - Traitement avec un gaz ou une vapeurTraitement avec des liquides vaporisables au contact du catalyseur épuisé avec de l'hydrogène élémentaire
• B01J 38/14 - Traitement avec un gaz contenant de l'oxygène libre en réglant la teneur en oxygène dans le gaz d'oxydation
• C07C 5/32 - Préparation d'hydrocarbures à partir d'hydrocarbures contenant le même nombre d'atomes de carbone par déshydrogénation avec formation d'hydrogène libre

Abrégé

This disclosure relates to the use of 1-methyl-6,7-dihydro-5H-cyclopenta[b]pyridine-1-ium cation as structure directing agent (SDA) for the preparation of zeolites. This disclosure also relates to compositions of matter, designated as EMM-64 and EMM-65, obtainably by using this SDA, as well as a method of making the same and uses thereof. This disclosure further relates to a method of making an aluminosilicate molecular sieve of RTH framework type using said SDA, aluminosilicate molecular sieves of RTH framework type obtainable by said method, and uses thereof.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique
• B01J 29/70 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes de types caractérisés par leur structure spécifique non prévus dans les groupes
• B01J 29/86 - BorosilicatesAluminoborosilicates
• B01J 37/00 - Procédés de préparation des catalyseurs, en généralProcédés d'activation des catalyseurs, en général
• B01J 37/03 - PrécipitationCo-précipitation
• B01J 37/04 - Mélange
• B01J 37/10 - Traitement thermique en présence d'eau, p. ex. de vapeur d'eau
• C01B 39/12 - Préparation de zéolites isomorphes caractérisée par les mesures prises pour le remplacement des atomes d'aluminium ou de silicium dans la charpente du réseau par des atomes d'autres éléments les atomes de remplacement étant des atomes de bore
• C07D 221/04 - Systèmes cycliques condensés en ortho ou en péri

Abrégé

A method involves performing an enhanced oil recovery (EOR) operation. The method includes injecting a gas stream into a well via a first channel. The method also includes injecting enhanced oil recovery chemicals (EROCs) into the well via a second channel. The second channel is different from the first channel. An end of the first channel and an end of the second channel are positioned to facilitate static mixing of the gas stream with the EROCs to form an enriched gas stream in a subsurface region. The enriched gas stream facilitates the EOR operation.

Classes IPC  ?

• E21B 43/16 - Procédés de récupération assistée pour l'extraction d'hydrocarbures
• E21B 43/25 - Procédés pour activer la production

Abrégé

A jet boiling range composition is provided with an unexpected distribution of carbon chain lengths for the hydrocarbons and paraffins in the composition. The hydrocarbon composition corresponds to a jet boiling range composition that includes 40 wt % or more of hydrocarbons and/or paraffins that have carbon chain lengths of 17 carbons or 18 carbons. Additionally or alternately, the hydrocarbon composition can contain 45 wt % or less of C14-C17 hydrocarbons and/or paraffins. This unexpected distribution of carbon chain lengths in a jet boiling range composition can be achieved for a composition that has a freeze point of −40° C. or lower and a flash point of 38° C. or higher. Optionally, the jet boiling range composition can also have a T10 distillation point of 205° C. or less (such as down to 150° C.) and a final boiling point of 300° C. or less

Classes IPC  ?

• C10L 1/08 - Combustibles carbonés liquides à base essentielle de mélanges d'hydrocarbures pour allumage par compression
• C10G 69/02 - Traitement des huiles d'hydrocarbures par au moins un procédé d'hydrotraitement et au moins un autre procédé de conversion uniquement par plusieurs étapes en série

Abrégé

Molecular sieves, designated as EMM-73, are provide. The molecular sieves are characterized by a unique powder XRD pattern. Both as-synthesized and calcined forms of the EMM-73 molecular sieves are provided. Methods of making the EMM-73 molecular sieves, as well as methods of using the EMM-73 molecular sieves, are also provided.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique
• B01J 29/70 - Zéolites aluminosilicates cristallinesLeurs composés isomorphes de types caractérisés par leur structure spécifique non prévus dans les groupes
• B01J 37/00 - Procédés de préparation des catalyseurs, en généralProcédés d'activation des catalyseurs, en général
• B01J 37/03 - PrécipitationCo-précipitation
• B01J 37/04 - Mélange
• B01J 37/08 - Traitement thermique
• B01J 37/30 - Échange d'ions
• C01B 39/02 - Zéolites aluminosilicates cristallinesLeurs composés isomorphesLeur préparation directeLeur préparation à partir d'un mélange réactionnel contenant une zéolite cristalline d'un autre type, ou à partir de réactants préformésLeur post-traitement
• C01B 39/12 - Préparation de zéolites isomorphes caractérisée par les mesures prises pour le remplacement des atomes d'aluminium ou de silicium dans la charpente du réseau par des atomes d'autres éléments les atomes de remplacement étant des atomes de bore

Abrégé

Methods are provided for upgrading of pyrolysis carbon in order to allow for conversion of the pyrolysis carbon into higher value products. Instead of attempting to convert methane into a high value carbon product (such as carbon nanotubes) and H2 in a single reaction step, pyrolysis conditions can be used to form H2 and pyrolysis carbon. The pyrolysis carbon can then be treated in order to convert the pyrolysis carbon (H to C atomic ratio of less than 0.20) into a product with a higher hydrogen content (H to C atomic ratio of 0.25-0.9 or 2.0-7.0 wt % H). The treatment can correspond to exposing the pyrolysis carbon with hydrogen in the presence of a catalyst, exposing the pyrolysis carbon to conditions for alkylation, or a sequential combination thereof. This can convert the pyrolysis carbon into heavy hydrocarbon products that are resin-like solids at room temperature.

Classes IPC  ?

• C10G 1/08 - Production de mélanges liquides d'hydrocarbures à partir de schiste bitumineux, de sable pétrolifère ou de matières carbonées solides non fusibles ou similaires, p. ex. bois, charbon par hydrogénation destructive avec catalyseurs mobiles
• C01B 3/24 - Production d'hydrogène ou de mélanges gazeux contenant de l'hydrogène par décomposition de composés organiques gazeux ou liquides d'hydrocarbures

Abrégé

An amine-modified metal-organic framework composition is provided that has beneficial properties for performing direct air capture. The composition corresponds to a mixed-metal organic framework that includes 4,4'-dioxidobiphenyl-3,3'-dicarboxylate (dobpdc) as the linker. The mixed metals can correspond to two or more metals. In some aspects, the mixed-metal organic framework corresponds to M1xxM2(2-x)(2-x) (dobpdc). In various aspects, the mixed-metal organic framework is appended with N,N' -diethylethylenediamine (e-2-e).

Classes IPC  ?

• B01J 20/22 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance organique
• B01D 53/02 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse
• B01J 20/28 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation caractérisées par leur forme ou leurs propriétés physiques
• B01J 20/32 - Imprégnation ou revêtement
• B01J 20/34 - Régénération ou réactivation

Abrégé

Composite powders may be formed by blending silicon particles with petroleum pitch under grinding conditions. The composite powders may comprise up to about 50 wt.% silicon particles, based on total mass of the composite powder, and about 15 wt.% to about 95 wt.% petroleum pitch, based on total mass of the composite powder, and, optionally, up to 80 wt.% graphite particles. The silicon particles are dispersed in a matrix comprising the petroleum pitch and the petroleum pitch comprises a plurality of pitch particles. The composite powders may be subsequently converted to a carbon matrix comprising amorphous carbon by heating the petroleum pitch at a temperature of about 700°C to about 1800°C in an environment comprising about 0.1 mol% oxygen or below.

Classes IPC  ?

• C01B 32/205 - Préparation
• H01M 4/13 - Électrodes pour accumulateurs à électrolyte non aqueux, p. ex. pour accumulateurs au lithiumLeurs procédés de fabrication
• H01M 4/36 - Emploi de substances spécifiées comme matériaux actifs, masses actives, liquides actifs
• H01M 4/38 - Emploi de substances spécifiées comme matériaux actifs, masses actives, liquides actifs d'éléments simples ou d'alliages
• H01M 4/587 - Matériau carboné, p. ex. composés au graphite d'intercalation ou CFx pour insérer ou intercaler des métaux légers

Abrégé

An amine-modified metal-organic framework composition is provided that has beneficial properties for performing direct air capture. The composition corresponds to a mixed-metal organic framework that includes 4,4′-dioxidobiphenyl-3,3′-dicarboxylate (dobpdc) as the linker. The mixed metals can correspond to two or more metals. In some aspects, the mixed-metal organic framework corresponds to M1xM2(2-x) (dobpdc). In various aspects, the mixed-metal organic framework is appended with N,N′-diethylethylenediamine (e-2-e).

Classes IPC  ?

• B01J 20/22 - Compositions absorbantes ou adsorbantes solides ou compositions facilitant la filtrationAbsorbants ou adsorbants pour la chromatographieProcédés pour leur préparation, régénération ou réactivation contenant une substance organique
• B01D 53/04 - Séparation de gaz ou de vapeursRécupération de vapeurs de solvants volatils dans les gazÉpuration chimique ou biologique des gaz résiduaires, p. ex. gaz d'échappement des moteurs à combustion, fumées, vapeurs, gaz de combustion ou aérosols par adsorption, p. ex. chromatographie préparatoire en phase gazeuse avec adsorbants fixes

Abrégé

Pitch particles may be produced by a grinding process, in which pitch fines may be recovered and recycled to a grinding apparatus as a pitch melt. Such methods may comprise: providing a petroleum pitch having a first softening temperature; grinding the petroleum pitch in a grinding apparatus below the first softening temperature to produce a plurality of pitch particles and a plurality of pitch fines; separating the pitch particles from the pitch fines; heating the pitch fines at a temperature above the first softening temperature to produce a pitch melt; and combining the pitch melt with the petroleum pitch in the grinding apparatus. The pitch melt hardens in the grinding apparatus and is reground. The pitch particles may be further stabilized by heating at a treatment temperature below the first softening temperature in an environment comprising about 1 mol% to about 20 mol% oxygen to form stabilized pitch particles.

Classes IPC  ?

• C10G 31/06 - Raffinage des huiles d'hydrocarbures, en l'absence d'hydrogène, par des méthodes non prévues ailleurs par chauffage, refroidissement ou traitement par la pression
• C10C 3/00 - Traitement du brai, de l'asphalte, du bitume

Abrégé

Composite powders for electrode production may be formed by blending a graphitization catalyst or precursor thereof with petroleum pitch under grinding conditions. The composite powders may comprise about 0.1 wt.% to about 30 wt.% graphitization catalyst or a precursor thereof, based on total mass of the composite powder, and about 20 wt.% to about 99.9 wt.% petroleum pitch, based on total mass of the composite powder. The graphitization catalyst or the precursor thereof is dispersed in a matrix comprising the petroleum pitch, and the petroleum pitch comprises a plurality of pitch particles. The composite powders may be subsequently carbonized and then graphitized under conditions that may be less severe than un-catalyzed graphitization. The grinding conditions for forming the composite powders may include melt blending to form a continuous pitch matrix, wherein at least a portion of the graphitization catalyst or the precursor thereof may be dispersed within an interior of the pitch particles.

Classes IPC  ?

• C01B 32/205 - Préparation
• H01M 4/133 - Électrodes à base de matériau carboné, p. ex. composés d'intercalation du graphite ou CFx
• H01M 4/36 - Emploi de substances spécifiées comme matériaux actifs, masses actives, liquides actifs
• H01M 4/587 - Matériau carboné, p. ex. composés au graphite d'intercalation ou CFx pour insérer ou intercaler des métaux légers

Abrégé

A lubricant composition may be used as an engine oil. Such lubricant compositions may, for example, include: from about 25.0 mass % to about 99.8 mass % of an oil base stock, based on a total mass of the lubricant composition, the oil base stock including at least one bio-sourced basestock and at least one alkyl naphthalene; and wherein the lubricant composition includes about 0.05 mass % or less phosphorus, about 0.05 mass % or less sulfur, and about 0.5 mass % or less ash.

Classes IPC  ?

• C10M 169/04 - Mélanges de matériaux de base et d'additifs
• C10M 105/04 - Hydrocarbures définis aliphatiques
• C10M 105/06 - Hydrocarbures définis aromatiques
• C10M 129/50 - Acides carboxyliquesLeurs sels comportant des groupes carboxyle liés à un atome de carbone d'un cycle aromatique à six chaînons monocarboxyliques
• C10M 129/74 - Esters de composés polyhydroxylés
• C10M 133/12 - Amines, p. ex. polyalkylènepolyaminesAmines quaternaires comportant des groupes amine liés à un atome de carbone d'un cycle aromatique à six chaînons
• C10M 135/10 - Acides sulfoniques ou leurs dérivés
• C10M 141/08 - Compositions lubrifiantes caractérisées en ce que l'additif est un mélange d'au moins deux composés couverts par plus d'un des groupes principaux , chacun de ces composés étant un composé essentiel l'un d'eux, au moins, étant un composé organique contenant du soufre, du sélénium ou du tellure
• C10N 30/00 - Propriétés physiques ou chimiques particulières améliorées par l'additif caractérisant la composition lubrifiante, p. ex. additifs multifonctionnels
• C10N 30/04 - Propriétés détergentes ou dispersantes
• C10N 30/06 - OnctuositéRésistance du filmAnti-usureRésistance aux pressions extrêmes
• C10N 30/10 - Inhibition de l'oxydation, p. ex. anti-oxydants
• C10N 40/25 - Moteurs à combustion interne

Abrégé

The present disclosure relates to catalyst systems containing catalyst compounds and activators, and uses thereof. In some embodiments, a solution catalyst system includes a solution of aluminoxane comprising either anion modified alkylaluminoxane, and/or a cation modified alkylaluminoxane, the alkylaluminoxane composition having 0 wt% to about 2 wt% Al from non-coordinated trihydrocarbyl aluminum compound, based on total aluminum content of the alkylaluminoxane composition as determined by titration of the alkylaluminoxane composition with tetrahydrofuran. The catalyst system includes a compound represented by Formula (I).

Classes IPC  ?

• C08F 210/02 - Éthylène
• C08F 4/52 - MétauxHydrures métalliquesComposés organiques de métalLeur utilisation comme précurseurs de catalyseurs choisis parmi les métaux légers, le zinc, le cadmium, le mercure, le cuivre, l'argent, l'or, le bore, le gallium, l'indium, le thallium, les terres rares ou les actinides choisis parmi le bore, l'aluminium, le gallium, l'indium, le thallium ou les terres rares

Abrégé

The present disclosure relates to alumoxane compositions substantially or completely free of non-coordinated hydrocarbyl aluminum content, methods of forming such alumoxane compositions, catalyst systems having the alumoxane compositions, and methods of polymerizing olefins using catalyst systems having the alumoxane compositions. In some embodiments, a catalyst system includes at least one pre-catalyst compound. The catalyst system includes an unsupported or supported alumoxane. The alumoxane includes a monodentate siloxy ligand. In some embodiments, a method of making an alumoxane includes forming an ionic alkylalumoxane by reacting a supported or unsupported alkylalumoxane with a polydentate chelating agent to form a silane alkylaluminum complex. The method includes heating or aging the silane alkylaluminum complex to form a supported or unsupported alkylalumoxane comprising a monodentate ligand.

Classes IPC  ?

• C08F 10/00 - Homopolymères ou copolymères d'hydrocarbures aliphatiques non saturés contenant une seule liaison double carbone-carbone
• C08F 4/659 - Composant couvert par le groupe contenant une liaison métal de transition-carbone
• C08F 210/16 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP
• C08F 110/06 - Propène
• C08F 110/14 - Monomères contenant au moins cinq atomes de carbone
• C07F 5/06 - Composés de l'aluminium
• C08F 4/64 - Titane, zirconium, hafnium ou leurs composés
• C08F 4/6592 - Composant couvert par le groupe contenant une liaison métal de transition-carbone contenant au moins un cycle cyclopentadiényle, condensé ou non, p. ex. un cycle indényle ou fluorényle

Abrégé

The present disclosure relates to alumoxane compositions substantially or completely undetectable alkylaluminum content, methods of forming such alumoxane compositions, catalyst systems having the alumoxane compositions, and methods of polymerizing olefins using catalyst systems having the alumoxane compositions. In some embodiments, the present disclosure relates to unsupported or supported MAO compositions, methods of forming MAO, catalyst systems having MAO, and methods of polymerizing olefins using catalyst systems having MAO. In some embodiments, a method of making an unsupported or supported MAO with undetectable or low free trihydrocarbyl aluminum includes introducing an unsupported or supported MAO with an electron withdrawing compound to form an unsupported or supported MAO composition with undetectable or low free trihydrocarbyl aluminum.

Classes IPC  ?

• C08F 4/00 - Catalyseurs de polymérisation
• B01J 31/14 - Catalyseurs contenant des hydrures, des complexes de coordination ou des composés organiques contenant des composés organiques ou des hydrures métalliques contenant des composés organométalliques ou des hydrures métalliques d'aluminium ou de bore

Abrégé

A method for controlling the growth of a hydraulic fracture using a stress shadow generated during a hydraulic fracturing operation includes selecting a stage pair including a first stage and a second stage for which hydraulic fractures are to be generated via a hydraulic fracturing operation. The method also includes hydraulic fracturing the first stage to generate a corresponding first hydraulic fracture and controlling a magnitude of a stress shadow originating from the first hydraulic fracture by varying at least one parameter of the hydraulic fracturing operation, where the stress shadow is controlled so as to provide a second hydraulic fracture of a target fracture shape for the second stage. The method further includes hydraulic fracturing the second stage to generate the second hydraulic fracture with the target fracture shape.

Classes IPC  ?

• E21B 43/26 - Procédés pour activer la production par formation de crevasses ou de fractures

Abrégé

The present disclosure relates to a method of forming a composition including forming a polymer melt in a melt feeder. The melt feeder is coupled with an extruder. The method includes introducing the polymer melt from the melt feeder to the extruder at a first location of the extruder. The method includes extruding the polymer melt through the extruder via a plurality of intermeshing screws disposed within the extruder. The method includes introducing a coupling agent to the extruder at a second location of the extruder.

Classes IPC  ?

• B29B 7/48 - MélangeMalaxage continu, avec dispositifs mécaniques de mélange ou de malaxage avec dispositifs de mélange ou de malaxage mobiles rotatifs avec plus d'un arbre à dispositifs à engrènement, p. ex. à vis qui s'engrènent
• B29B 7/60 - Éléments constitutifs, détails ou accessoiresOpérations auxiliaires pour alimentation, p. ex. pièces de guidage pour la matière à traiter
• B29B 7/84 - Ventilation ou dégazage
• B29B 9/02 - Fabrication de granulés par division de matière préformée
• B29K 23/00 - Utilisation de polyalcènes comme matière de moulage
• B29K 105/00 - Présentation, forme ou état de la matière moulée
• B29L 30/00 - Pneumatiques, bandages pleins ou leurs parties constitutives
• B60C 1/00 - Pneumatiques caractérisés par la composition chimique, la disposition ou le mélange physique de la composition
• C08F 8/42 - Introduction d'atomes métalliques ou de groupes contenant des atomes métalliques

Abrégé

A system and method of extracting elements from an aqueous stream are described herein. The method includes designing a process to extract at least two elements from the aqueous product stream. The at least two elements have different commercial values. The process is optimized to minimize a cost of extracting the at least two elements and to maximize a value of extracting the at least two elements. The method further includes extracting the at least two elements according to the process.

Classes IPC  ?

• C22B 60/00 - Obtention des métaux ayant un nombre atomique de 87 ou plus, c.-à-d. métaux radioactifs
• B01D 61/02 - Osmose inverseHyperfiltration
• C22B 3/22 - Traitement ou purification de solutions, p. ex. de solutions obtenues par lixiviation par des procédés physiques, p. ex. par filtration, par des moyens magnétiques
• C22B 3/24 - Traitement ou purification de solutions, p. ex. de solutions obtenues par lixiviation par des procédés physiques, p. ex. par filtration, par des moyens magnétiques par adsorption sur des substances solides, p. ex. par extraction avec des résines solides
• C22B 26/12 - Obtention du lithium

Abrégé

Various zeolites may be produced under hydrothermal synthesis conditions in the presence of a silicon atom source and a bis-pyridinium compound having a structure represented by formula (I). Q is an optionally substituted C1-C10 hydrocarbyl group and two Q may join to form a carbocyclic ring; n is an integer ranging from 0 to 5; m is an integer ranging from 0 to 5; n+m is greater than or equal to 1; and A is a spacer group containing 2 to about 10 atoms. Various zeolites may be produced under hydrothermal synthesis conditions in the presence of a silicon atom source and a bis-pyridinium compound having a structure represented by formula (I). Q is an optionally substituted C1-C10 hydrocarbyl group and two Q may join to form a carbocyclic ring; n is an integer ranging from 0 to 5; m is an integer ranging from 0 to 5; n+m is greater than or equal to 1; and A is a spacer group containing 2 to about 10 atoms.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique

Abrégé

The present disclosure relates to the use of at least one cation selected from 1,2,3,5-tetramethylbenzimidazolium cation, 1,2,3,4,5-pentamethylbenzimidazolium cation, and 1,2,3,4,6-pentamethylbenzimidazolium cation as a structure directing agent for the preparation of molecular sieves. This disclosure also relates to a method of making molecular sieves using said structure directing agents, and to molecular sieves comprising said structure directing agents.

Classes IPC  ?

• C01B 39/48 - Autres types caractérisés par leur diagramme de diffraction des rayons X et par leur composition définie utilisant au moins un agent structurant organique

Abrégé

A system and method of extracting elements from an aqueous stream are described herein. The method includes designing a process to extract at least two elements from the aqueous product stream. The at least two elements have different commercial values. The process is optimized to minimize a cost of extracting the at least two elements and to maximize a value of extracting the at least two elements. The method further includes extracting the at least two elements according to the process.

Classes IPC  ?

• C02F 1/28 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par absorption ou adsorption
• B01D 61/02 - Osmose inverseHyperfiltration
• C02F 1/44 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par dialyse, osmose ou osmose inverse
• C02F 1/52 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par floculation ou précipitation d'impuretés en suspension
• B01D 61/10 - AccessoiresOpérations auxiliaires
• C02F 1/26 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par extraction
• C02F 1/42 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par échange d'ions
• C02F 1/66 - Traitement de l'eau, des eaux résiduaires ou des eaux d'égout par neutralisationAjustage du pH
• C02F 101/10 - Composés inorganiques
• C02F 103/06 - Eau souterraine contaminée ou eau de lessivage
• C02F 103/10 - Nature de l'eau, des eaux résiduaires ou des eaux ou boues d'égout à traiter provenant de carrières ou d'activités minières
• C02F 103/36 - Nature de l'eau, des eaux résiduaires ou des eaux ou boues d'égout à traiter provenant de l'industrie chimique non prévue dans les groupes provenant de la fabrication de composés organiques

Abrégé

The present disclosure relates to catalysts, catalyst systems, polyethylene polymers, polymerization processes for making such polyethylene polymers, and films made therefrom. In some embodiments, a catalyst compound is represented by Formula (I) wherein M is Zr or Hf; R5and R6are each hydrogen; each of R1, R2, R3, and R411010 alkyl; one of (1) R7and R8, (2) R8and R9, or (3) R9and R10are joined to form a substituted or unsubstituted aromatic ring or saturated ring fused to the indenyl ring shown in Formula (I), and the remainder of R7, R8, R9, and R1034040 alpha-olefin to a catalyst system in a reactor, and forming a polyethylene composition.

Classes IPC  ?

• C08F 210/16 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP
• C08F 4/659 - Composant couvert par le groupe contenant une liaison métal de transition-carbone
• C07F 17/00 - Metallocènes
• B32B 27/00 - Produits stratifiés composés essentiellement de résine synthétique

Abrégé

The present disclosure relates to catalysts, catalyst systems, polyethylene polymers, polymerization processes for making such polyethylene polymers, and films made therefrom. In some embodiments, an unbridged catalyst compound is represented by Formula (II). M is a group 4 metal. Each of R1, R2, R3, R4, R7, R8, R9, R10, R11, R14, R15, R15, R16, R16, R17, R17, R18, R18', R19, R19, R20, R20, R21, R21, R22, and R22 is independently hydrogen, a substituted or unsubstituted hydrocarbyl, a substituted or unsubstituted heteroatom, or a substituted or unsubstituted heteroatom-containing group. Each X is independently a halide, a substituted or unsubstituted hydrocarbyl, a hydride, an amide, a substituted or unsubstituted alkoxide, a sulfide, a phosphide, or a combination thereof, or two of X are joined together to form a substituted or unsubstituted metallocycle ring, or two of X are joined to form a chelating ligand, a diene ligand, or an alkylidene.

Classes IPC  ?

• C08F 210/16 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP
• C08F 4/659 - Composant couvert par le groupe contenant une liaison métal de transition-carbone
• C07F 9/66 - Composés de l'arsenic
• B32B 27/00 - Produits stratifiés composés essentiellement de résine synthétique

Abrégé

The present disclosure relates to catalysts, polyethylene polymers, polymerization processes for making such polyethylene polymers, and films made therefrom. In some embodiments, a catalyst system includes a first catalyst compound. The first catalyst compound is represented by Formula (I). At least one of R4and R5, R5and R6, or R6and R7of Formula (I) are joined to form a first substituted or unsubstituted completely saturated ring fused to the indenyl ring and at least one of R11and R12, R12and R13, or R13and R14are joined to form a second substituted or unsubstituted completely saturated ring fused to the indenyl ring. The catalyst system further includes a second catalyst represented by Formula (III). At least one of R7and R8, R8and R9, or R9and R10 of Formula (III) are joined to form a substituted or unsubstituted completely saturated ring fused to the indenyl ring.

Classes IPC  ?

• C08F 210/16 - Copolymères de l'éthylène avec des alpha-alcènes, p. ex. caoutchoucs EP
• C08F 4/659 - Composant couvert par le groupe contenant une liaison métal de transition-carbone
• B32B 27/32 - Produits stratifiés composés essentiellement de résine synthétique comprenant des polyoléfines
• C07F 9/66 - Composés de l'arsenic